Recombinant Salmonella typhimurium UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; STM3153; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: stm:STM3153

STRING: 99287.STM3153

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional role of YqhA in Salmonella typhimurium, and how does it influence bacterial stress adaptation?
    YqhA belongs to the UPF0114 family of uncharacterized transmembrane proteins. In E. coli, YqhA homologs are implicated in stress modulation, particularly in responding to lignocellulosic inhibitors (e.g., furfural, vanillin) by regulating oxidoreductase activity via the yqhD-dgkA operon . In Salmonella, YqhA may share similar roles, as recombinant strains expressing YqhA are used to study immune responses and cellular tolerance. Methodologically, its function can be investigated via:

    • Knockout studies: Compare wild-type and ΔyqhA strains under stress conditions (e.g., bile, oxidative stress).

    • Transcriptomics: Profile yqhD-dgkA operon expression in ΔyqhA mutants .

    • Structural homology: Use low-confidence homology models (e.g., Bacillus subtilis RsbR) to predict ligand-binding domains .

    Key Data:

    OrganismMutationFunctional ImpactReference
    E. coliW14L (Tryptophan → Leucine)Altered hydrophobic core stability; enhanced tolerance to furfural
  • Why is Salmonella typhimurium a preferred vector for recombinant YqhA expression in mucosal immunity studies?
    Salmonella’s ability to colonize mucosal surfaces and deliver antigens to immune cells makes it ideal for oral vaccine development. Recombinant Salmonella vectors expressing YqhA or other antigens induce dual systemic and mucosal immunity . Key methodological considerations:

    • Chromosomal vs. plasmid-based expression: Chromosomal integration improves antigen stability, while plasmids enable higher gene dosage .

    • Attenuation strategies: Δcya Δcrp Δasd mutants reduce virulence while maintaining immunogenicity .

    • Prime-boost regimens: Combine plasmid DNA vaccines with bacterial ghosts (BGs) to enhance immune responses .

    Example Protocol:

    • Oral immunization: Administer 10⁹ CFU of attenuated S. typhimurium χ3987(pYA2905) expressing YqhA to rats .

    • Immune readouts: Measure IgA in saliva and IgG in serum via ELISA .

  • What are the standard methodologies for expressing and purifying recombinant YqhA in E. coli?
    Recombinant YqhA is typically expressed in E. coli BL21(DE3) with a His-tag for affinity purification . Critical steps include:

    • Vector design: Use pET or pSM1 plasmids with T7/lac promoters for high-yield expression.

    • Solubility optimization: Test induction temperatures (16–37°C) and detergent additives (e.g., Triton X-100).

    • Purification: Ni-NTA chromatography followed by size-exclusion chromatography (SEC) to ≥90% purity .

    Typical Yield:

    HostTagPurityStorage Buffer
    E. coliHis>90%Tris/PBS + 6% trehalose, pH 8.0

Advanced Research Questions

  • How do structural uncertainties in YqhA complicate mechanistic studies, and what experimental approaches resolve this?
    YqhA’s transmembrane domains and low-confidence homology models (e.g., 48% identity to Bacillus Mrp antiporter) hinder structure-function analysis . Strategies include:

    • Cryo-EM: Resolve full-length YqhA in lipid nanodiscs.

    • Site-directed mutagenesis: Target conserved residues (e.g., W14, L245) to assess ligand-binding or regulatory roles .

    • Crosslinking mass spectrometry: Identify interaction partners (e.g., BasR, RssB) in stress signaling pathways .

    Case Study:

    • The W14L mutation in E. coli YqhA increased hydrophobicity, correlating with enhanced furfural tolerance .

  • How can researchers address bottlenecks in Salmonella-vectored YqhA vaccine studies, such as inter-animal variability in founder populations?
    A severe bottleneck (1:1,000,000 colonization efficiency) and compartmentalized gut populations were observed in murine models . Mitigation approaches:

    • Barcoded libraries: Use STAMPR pipeline with ~55,000 unique barcodes to track founder dynamics .

    • Microbiota modulation: Pre-treat mice with streptomycin to reduce niche competition .

    Key Data:

    TreatmentFounder Population DiversityPathogen Sharing Between Organs
    UntreatedLow (≤10 barcodes)Minimal (e.g., intestine vs. spleen)
    StreptomycinHigh (>100 barcodes)Increased reseeding via bile
  • What functional redundancy exists between YqhA and other stress-response regulators (e.g., RssB, BasR)?
    Adaptive evolution experiments in E. coli revealed co-occurring mutations in yqhA, rssB, and basR under inhibitor stress . Redundancy mechanisms:

    • RssB: Degrades RpoS (stationary-phase sigma factor), linking YqhA to biofilm formation .

    • BasR: Modulates acid resistance; Y98H mutation enhances ethanol tolerance .

    Experimental Design:

    • CRISPR interference: Knock down yqhA, rssB, or basR individually/combinatorially.

    • Phenotypic screening: Assess survival under furfural, ethanol, or bile stress.

Methodological Challenges and Solutions

  • How can contradictory findings about YqhA’s role in oxidative stress be reconciled across studies?
    Discrepancies arise from species-specific contexts (Salmonella vs. E. coli) and experimental conditions (aerobic vs. anaerobic). Solutions:

    • Standardized assays: Use H₂O₂ disc diffusion under controlled O₂ levels.

    • Transcriptomic validation: Compare ΔyqhA vs. WT RNA-seq data in stress conditions .

  • What computational tools are recommended for predicting YqhA’s ligand-binding sites despite low homology?

    • AlphaFold2: Predicts de novo structures with confidence metrics (pLDDT >70).

    • DALI: Matches YqhA’s predicted folds to distant homologs (e.g., Mrp antiporters).

    • MD simulations: Simulate W14L mutant stability in lipid bilayers .

  • How do population dynamics of recombinant Salmonella expressing YqhA affect experimental reproducibility?
    Clonal expansion in systemic organs (e.g., spleen) versus polyclonal gut populations introduces variability . Controls:

    • Inoculum standardization: Use optical density (OD₆₀₀) and CFU counts.

    • Barcode normalization: Spike-in control barcodes for quantitative PCR .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.