Recombinant Salmonella typhimurium UPF0187 protein yneE (yneE)

Shipped with Ice Packs
In Stock

Description

General Information

Salmonella typhimurium is a non-host-specific serovar that causes health concerns in humans and animals, leading to economic challenges worldwide . Salmonella species utilize outer membrane proteins to transport molecules across membranes .

Function and Characteristics of yneE

  • Role in Antibiotic Susceptibility and Virulence YneE's deficiency impacts bacterial growth when treated with antibiotics, and its absence remarkably enhances Salmonella virulence .

  • pH-Dependent Conversion YneE undergoes pH-dependent stoichiometric conversion between dimeric and tetrameric states .

  • Structural Analysis Structural analysis via X-ray crystallography and small-angle X-ray scattering has provided insights into its structural properties .

YfdX Protein

YfdX is a prokaryotic protein encoded by several pathogenic bacteria including Salmonella enterica serovar Typhi, which causes typhoid fever . YfdX is a product of the yfdXWUVE operon and is known to be under the control of EvgA, a regulator protein controlling the expression of several proteins involved in response to environmental stress, in Escherichia coli .

Applications in Vaccine Development

The invH gene product of Salmonella is a crucial component of the type 3 secretion system's needle complex. Recombinant invH protein has been studied for its potential as a vaccine candidate against Salmonella infections .

Outer Membrane Protein A (OmpA)

OmpA is an outer membrane protein that contributes to the survival of Salmonella typhimurium within macrophages and helps the bacteria withstand the nitrosative stress from macrophages by maintaining outer membrane stability . An ompA deficient strain of Salmonella (STM ΔompA) showed compromised proliferation in macrophages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yneE; STM1527; UPF0187 protein YneE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yneE
Target Protein Sequence
MIVRPQQHWIRLIFVWHGSVLSKIFSRLLLNFLLSIAVIIMLPWYTMLGIKFTLAPFSIL GVAIAIFLGFRNNACYARYVEARHLWGQLMIASRSILREVKTTLPDERGIEDFVRLQIAF AHCLRMTLRRQPQTQVLGNYLDQEALQKVVASHSPANRILLLMGEWLAIRRRSGKLSDIL FHSLNNRLNDMSSVLAGCERIANTPVPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFIALDALAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDERDIPAKRIPDKR YQLT
Uniprot No.

Target Background

Database Links

KEGG: stm:STM1527

STRING: 99287.STM1527

Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0187 protein yneE and what is its functional significance?

The UPF0187 protein yneE (also designated as SirA - sporulation inhibitor of replication) is a conserved bacterial protein that functions as an inhibitor of DNA replication. First characterized in Bacillus subtilis, it plays a critical role during sporulation by reducing chromosome copy number . The protein contains 304 amino acids in its full-length form and has been identified in several bacterial species, including Salmonella and E. coli . Its primary significance lies in its ability to regulate DNA replication during specific developmental processes, particularly during the transition from growth to sporulation states in bacteria .

How is yneE regulated in bacterial cells?

YneE expression is directly controlled by Spo0A, a master regulator of sporulation in Bacillus subtilis. When Spo0A is phosphorylated (Spo0A~P), it activates the transcription of yneE along with other sporulation-specific genes . This regulation ensures that yneE is expressed at appropriate times during the bacterial life cycle, specifically when cells are preparing to undergo sporulation. Flow cytometry analysis has demonstrated that the induction of Spo0A activity results in reduced DNA content in cells, and this effect is partially dependent on yneE expression .

What molecular mechanisms enable yneE to inhibit DNA replication?

Current research indicates that yneE inhibits DNA replication through direct or indirect interference with the replication machinery. When artificially expressed during vegetative growth, yneE causes impaired viability and produces anucleate cells, indicating disruption of normal chromosome segregation and cell division . The molecular mechanism likely involves interaction with key components of the replication initiation complex, potentially preventing assembly or activation of the replication fork.

Advanced studies suggest a potential interaction with DnaA (the bacterial replication initiator protein) or other components required for replication initiation. The exact binding partners and signal transduction pathways remain areas requiring further investigation. Mass spectrometry-based interaction studies would be valuable to identify the direct targets of yneE during replication inhibition.

How does yneE function compare across different bacterial species?

While initially characterized in Bacillus subtilis, yneE homologs exist across multiple bacterial species including Salmonella typhimurium and E. coli . Comparative analysis reveals conservation of key functional domains, suggesting similar mechanistic roles despite species-specific adaptations. In B. subtilis, yneE clearly functions in sporulation regulation, while its role in non-sporulating bacteria like Salmonella typhimurium may differ, potentially relating to stress response or stationary phase adaptation.

The evolutionary conservation of yneE suggests fundamental importance in bacterial lifecycle regulation. Cross-species complementation experiments would help determine functional equivalence between homologs from different bacterial species.

What is the relationship between yneE and bacterial virulence or pathogenicity?

While not directly established in the available research, the potential role of yneE in bacterial virulence deserves investigation, particularly in pathogenic species like Salmonella typhimurium. DNA replication regulation influences bacterial adaptation to host environments, stress responses, and persistence.

By analogy, other virulence factors in Salmonella such as Hemolysin E (HlyE) have established roles in pathogenesis . Given that yneE controls cellular processes related to growth regulation, it may contribute to bacterial survival during host infection by modulating replication in response to host-derived stresses. Deletion mutant studies in infection models would help elucidate any direct role in virulence.

What are the optimal expression systems for recombinant yneE production?

Based on established protocols, E. coli expression systems have proven effective for recombinant production of UPF0187 protein yneE . The protein is typically expressed with an N-terminal His-tag to facilitate purification. The recommended expression parameters include:

ParameterRecommended Condition
Expression HostE. coli
Vector TypepET series or equivalent with T7 promoter
InductionIPTG (0.5-1.0 mM)
Temperature25-30°C (lower temperatures may improve solubility)
Duration4-6 hours or overnight at reduced temperature
PurificationNi-NTA affinity chromatography

For functional studies, it's critical to verify protein folding integrity through circular dichroism or limited proteolysis, as misfolded protein may lead to artifactual results in downstream applications .

How can researchers effectively study yneE's impact on DNA replication?

Several complementary approaches can be employed to investigate yneE's effects on DNA replication:

  • Controlled expression systems: Use of inducible promoters (e.g., IPTG-inducible) to express yneE at defined levels and monitor effects on chromosome content by flow cytometry .

  • Fluorescence microscopy: Utilizing DNA stains or fluorescently-tagged nucleoid proteins to visualize chromosome dynamics and segregation in real-time following yneE induction.

  • DNA synthesis measurement: Incorporation of nucleotide analogs (BrdU, EdU) to quantify DNA synthesis rates in response to yneE expression.

  • Chromatin immunoprecipitation (ChIP): To identify genomic regions where yneE or its complexes may associate with DNA.

  • In vitro replication assays: Using purified components to determine if yneE directly interferes with replication proteins like DnaA, primase, or DNA polymerase.

A combination of these approaches provides comprehensive insights into the inhibitory mechanisms of yneE on DNA replication.

What are the key considerations for generating and analyzing yneE knockout mutants?

When generating yneE knockout mutants for functional studies, researchers should consider:

  • Genetic background selection: The strain background can significantly influence phenotypic outcomes. Wild-type parent strains should be used as controls in all experiments.

  • Knockout strategy: Clean deletion mutants without antibiotic resistance markers are preferred to avoid polar effects on adjacent genes. CRISPR-Cas9 or lambda Red recombination systems are effective methods.

  • Complementation controls: Phenotypes should be restored by expressing yneE from a plasmid or at a neutral chromosomal locus to confirm phenotype specificity.

  • Growth conditions: Test mutants under various conditions including different growth phases, nutrient limitations, and stresses to comprehensively characterize the phenotype.

  • Synchronization techniques: For replication studies, cell synchronization methods improve the resolution of cell cycle effects.

Key phenotypic parameters to measure include:

  • Growth rate and viability

  • DNA content (flow cytometry)

  • Chromosome copy number (qPCR)

  • Cell morphology (microscopy)

  • Stress resistance profiles

  • Transcriptional responses (RNA-seq)

How can researchers distinguish direct versus indirect effects of yneE on cellular processes?

Distinguishing direct from indirect effects presents a significant challenge in yneE research. Recommended approaches include:

  • Temporal analysis: Implement time-course experiments with fine temporal resolution after yneE induction to identify primary (rapid) versus secondary (delayed) effects.

  • Protein-protein interaction studies: Employ techniques like bacterial two-hybrid, co-immunoprecipitation, or proximity labeling to identify direct interaction partners of yneE.

  • Domain mapping: Create truncated or point-mutated variants of yneE to correlate specific protein regions with observed phenotypes.

  • Suppressor screens: Identify mutations that alleviate yneE-induced growth defects, potentially revealing direct targets.

  • In vitro reconstitution: Test the effect of purified yneE protein on isolated cellular processes, such as DNA replication initiation in a cell-free system.

The integration of these approaches allows researchers to build a network model differentiating direct mechanistic interactions from downstream consequences.

What are the common pitfalls in interpreting yneE overexpression phenotypes?

Researchers should be cautious of several potential misinterpretations when analyzing yneE overexpression data:

  • Artifactual effects: Extreme overexpression can cause non-physiological protein aggregation or membrane disruption that does not reflect native function.

  • Dosage sensitivity: Phenotypes may vary dramatically with expression level, necessitating careful titration experiments.

  • Growth defect confounding: Severe growth inhibition can mask specific molecular mechanisms, as cells experiencing growth arrest show numerous secondary effects.

  • Host adaptation: Extended expression may select for suppressor mutations that counteract yneE effects, clouding interpretation of late time points.

  • System-specific differences: Results from heterologous expression systems may not fully recapitulate native functionality due to missing cofactors or interaction partners.

To mitigate these issues, researchers should implement tightly regulated expression systems, include appropriate controls, and verify key findings through multiple experimental approaches.

What structural studies would advance understanding of yneE function?

Structural characterization of yneE remains incomplete but would significantly advance functional understanding. Priority structural studies include:

  • High-resolution crystal or cryo-EM structure: Determining the three-dimensional structure would reveal functional domains and potential interaction surfaces.

  • Membrane topology analysis: Given the predicted transmembrane regions, defining the membrane orientation of yneE is crucial for understanding its localization and function.

  • Conformational dynamics: Techniques like hydrogen-deuterium exchange mass spectrometry would reveal structural changes upon binding to potential partners or effectors.

  • Co-crystal structures: Structures of yneE in complex with interaction partners would identify key binding interfaces for targeted mutagenesis.

These structural insights would enable structure-guided experimental design and potentially reveal druggable pockets for antimicrobial development.

How might yneE function as a target for antimicrobial development?

Given yneE's role in DNA replication inhibition, it presents intriguing possibilities for antimicrobial development:

  • As a direct target: Compounds that inhibit yneE function could potentially interfere with bacterial stress responses or sporulation, though this approach would likely be species-specific.

  • As a model system: Understanding the molecular mechanism by which yneE inhibits DNA replication could reveal novel vulnerabilities in the bacterial replication machinery.

  • Biotechnological applications: Controlled expression of yneE could be exploited for growth regulation in engineered bacterial systems or for inducible bacterial stasis in various applications.

Research in this direction would require verification of yneE's importance in clinically relevant contexts and extensive structure-function studies to enable rational drug design approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.