Recombinant Salmonella typhimurium UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciC; STM1734; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: stm:STM1734

STRING: 99287.STM1734

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of Salmonella typhimurium UPF0259 membrane protein YciC?

Salmonella typhimurium UPF0259 membrane protein YciC belongs to the uncharacterized protein family UPF0259, a group of bacterial membrane proteins with conserved domains across various bacterial species. While specific structural data for YciC is limited, insights from related Salmonella membrane proteins suggest it may contain transmembrane domains that anchor it within the bacterial membrane. Research on other Salmonella membrane proteins, such as YqiC, has demonstrated the formation of oligomeric structures through C-terminal coiled-coil domains, which significantly impact protein function and stability .

What expression systems are most effective for recombinant production of Salmonella typhimurium YciC?

Bacterial expression systems, particularly Escherichia coli-based platforms, are most commonly employed for recombinant production of Salmonella membrane proteins like YciC. For optimal expression, consider using E. coli BL21(DE3) or similar strains with T7 RNA polymerase-based expression vectors. Temperature modulation (typically lowering to 16-25°C during induction) and reduced inducer concentrations may improve proper folding of membrane proteins. For enhanced yields, specialized E. coli strains engineered for membrane protein expression, such as C41(DE3) or C43(DE3), may be preferable. Based on approaches used with similar membrane proteins, N-terminal tagging appears to be more effective than C-terminal tagging for purification while maintaining protein functionality .

What purification strategies should be considered for Salmonella membrane proteins like YciC?

A multi-step purification approach is recommended for Salmonella membrane proteins:

  • Membrane fraction isolation: Utilize differential centrifugation following cell lysis

  • Solubilization: Select appropriate detergents (DDM, LDAO, or Triton X-100) for membrane protein extraction

  • Affinity chromatography: Employ His-tag or other fusion tags for initial capture

  • Size exclusion chromatography: Remove aggregates and achieve buffer exchange

For YciC specifically, N-terminal tagging has shown better results in studies of similar Salmonella membrane proteins, as C-terminal tags may interfere with potential oligomerization domains. During affinity chromatography, gradual imidazole washing (20 mM) has been effective in removing non-specifically bound proteins while retaining the target protein .

How can researchers determine the oligomeric state of YciC and its functional significance?

To determine the oligomeric state of YciC and evaluate its functional significance, implement the following experimental approaches:

TechniqueApplicationExpected Outcome
Chemical CrosslinkingCovalent stabilization of protein complexesIdentification of oligomeric forms on SDS-PAGE
SEC-MALSNative state molecular weight determinationPrecise determination of oligomeric state in solution
Native PAGENon-denaturing protein complex analysisVisualization of intact oligomeric assemblies
Analytical UltracentrifugationSedimentation analysisDetermination of molecular mass and shape
Mutagenesis of Predicted Interface ResiduesTargeted disruption of oligomerizationCorrelation between oligomeric state and function

Research on related Salmonella membrane proteins has demonstrated that oligomerization can be critical for protein stability and function. For instance, the YqiC protein forms a homotrimer through its C-terminal coiled-coil domain, and this trimeric structure is essential for Salmonella virulence and colonization capacity . Similar structure-function relationships may exist for YciC, necessitating careful investigation of its oligomeric properties.

What approaches should be used to investigate potential protein-protein interactions of YciC?

To comprehensively characterize YciC protein-protein interactions (PPIs), employ a multi-method strategy:

  • Affinity Purification-Mass Spectrometry (AP-MS): Use tagged YciC as bait to capture interaction partners from bacterial lysates, followed by mass spectrometry identification. Applying stringent washing conditions (20 mM imidazole) during purification can help identify high-confidence interactors .

  • Bacterial Two-Hybrid Analysis: Test specific binary interactions by expressing YciC and potential partners as fusion proteins with split reporter domains.

  • Co-immunoprecipitation: Validate interactions using antibodies against YciC or potential partners in native conditions.

  • Crosslinking-MS: Apply chemical crosslinkers to stabilize transient interactions followed by MS analysis to identify interaction sites.

  • Comparative Analysis with Related Proteins: Consider YqiC's known interactions with electron transport chain components (SdhA, SdhB) and ATP synthase subunits as potential starting points for YciC interaction studies .

When analyzing potential interaction partners, focus on biochemical pathways relevant to membrane protein function, energy metabolism, and bacterial virulence, as these have been implicated in studies of related Salmonella membrane proteins .

How does within-host genomic diversity impact the interpretation of YciC functional studies?

Recent research on Salmonella genomic diversity within infected hosts reveals significant microevolutionary changes that can affect protein function interpretation. Studies examining multiple single-colony isolates from individual patients have demonstrated substantial within-host genetic variation . This genomic diversity has several implications for YciC research:

  • Sampling Considerations: Single-colony isolates may not represent the full diversity of YciC variants present during infection. Consider analyzing multiple isolates per sample (up to 20 per patient has been used in recent studies) .

  • Sequence Variation Impact: Single nucleotide polymorphisms (SNPs) in the YciC coding region may alter protein structure and function, potentially explaining variability in experimental results.

  • Structural Genomic Changes: Beyond point mutations, larger chromosomal rearrangements may affect YciC expression and regulation.

  • Resistance Determinant Distribution: Antimicrobial resistance patterns may vary among isolates from the same patient, affecting interpretation of YciC functional roles in resistance .

To address these challenges, researchers should consider hybrid sequencing approaches that capture both SNP-level and structural variation, and potentially examine multiple isolates when investigating YciC function in clinical or in vivo settings .

What are the optimal conditions for analyzing YciC membrane protein stability and folding?

For rigorous analysis of YciC stability and folding, employ these methodological approaches:

  • Differential Scanning Calorimetry (DSC): Measure thermal stability by determining melting temperature (Tm) in various buffer conditions (pH range 6.0-8.0, salt concentrations 50-500 mM).

  • Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure content and thermal stability through temperature-dependent CD measurements (190-260 nm).

  • Fluorescence-based Thermal Shift Assays: Use environmentally sensitive dyes like SYPRO Orange to monitor thermal unfolding in a high-throughput format.

  • Detergent Screening: Evaluate protein stability in different detergents using analytical size exclusion chromatography:

Detergent ClassExamplesOptimal Concentration
MaltosideDDM, DM1-2× CMC
GlucosideOG, NG1.5-3× CMC
Fos-cholineFC-12, FC-141-2× CMC
Neopentyl glycolLMNG, DMNG0.5-1× CMC
  • Reconstitution in Nanodiscs or Liposomes: Assess native-like membrane environment stability using MSP1D1 nanodiscs or POPC/POPG liposomes.

Based on studies of related Salmonella membrane proteins, maintaining the oligomeric state during purification and analysis is crucial for proper functional assessment. Techniques that preserve native protein-protein interactions should be prioritized .

What strategies can be employed to investigate the role of YciC in Salmonella virulence?

To systematically examine YciC's role in Salmonella virulence, implement these research strategies:

  • Gene Knockout and Complementation: Generate YciC deletion mutants (ΔyciC) and complement with wild-type and mutant variants to assess phenotypic changes.

  • Site-Directed Mutagenesis: Target conserved residues or predicted functional domains to create point mutations that maintain protein expression but alter specific functions.

  • Infection Models:

    • Cell culture models: Assess bacterial invasion and intracellular replication in epithelial cells and macrophages

    • Animal models: Evaluate colonization, systemic spread, and pathogenesis in mouse models

  • Transcriptomic and Proteomic Analysis: Compare wild-type and ΔyciC strains to identify differentially expressed genes and proteins related to virulence.

  • Bacterial Fitness Assays: Measure growth rates, stress resistance, and competitive index in various conditions.

Analysis of related Salmonella membrane proteins indicates potential involvement in energy metabolism through interactions with electron transport chain components, which subsequently impacts virulence factor assembly, such as flagella . Investigation of YciC should consider similar functional pathways, particularly examining potential interactions with energy production systems.

How can researchers account for Salmonella genomic diversity when studying YciC function?

To effectively address Salmonella genomic diversity in YciC functional studies:

  • Multiple Isolate Analysis: Analyze YciC sequence and function across multiple isolates from the same source to capture natural variation. Recent studies suggest that up to 20 isolates per sample may be necessary to capture significant diversity .

  • Whole Genome Sequencing: Implement hybrid sequencing approaches combining short and long reads to detect both SNPs and structural variants that might affect YciC expression or function.

  • Population-level Approaches: Consider sweep sequencing or pool-seq methods when individual colony sequencing is cost-prohibitive, though be aware of limitations in detecting minor alleles .

  • Comparative Genomics: Analyze YciC conservation and variation across Salmonella serovars and strains to identify conserved functional domains versus variable regions.

  • Validation Across Strain Collections: Test key findings in multiple reference strains and clinical isolates to ensure reproducibility across genomic backgrounds.

How should researchers interpret contradictory data when studying YciC function?

When encountering contradictory results in YciC functional studies, implement this systematic approach to data reconciliation:

Remember that contradictory data may reflect genuine biological complexity rather than experimental error. The dominant-negative effects observed with YqiC mutants illustrate how complex protein interactions can produce seemingly contradictory phenotypes through heterogeneous protein populations .

What bioinformatic approaches are most valuable for predicting YciC structure and function?

To maximize predictive insights into YciC structure and function, implement this multi-layered bioinformatic workflow:

  • Sequence Analysis:

    • Multiple sequence alignment across bacterial species

    • Conservation analysis to identify functionally important residues

    • Domain prediction using InterPro, Pfam, and SMART databases

  • Structural Prediction:

    • AlphaFold2 or RoseTTAFold for ab initio 3D structure prediction

    • Molecular dynamics simulations to assess stability and flexibility

    • Coiled-coil prediction tools (COILS, Paircoil2) to identify potential oligomerization domains, as observed in related proteins like YqiC

  • Functional Prediction:

    • Gene neighborhood analysis to identify functional associations

    • Co-expression network analysis across multiple conditions

    • Protein-protein interaction prediction using STRING database

  • Comparative Analysis with Characterized Proteins:

    • Structural alignment with experimentally determined structures of related proteins

    • Functional site prediction based on homologous proteins

  • Integration of Experimental Data:

    • Incorporation of proteomic data to validate expression and modification

    • Integration of mutagenesis results to refine structural models

Consider the structural and functional insights from well-characterized Salmonella membrane proteins as templates. For instance, YqiC's trimeric organization through its C-terminal coiled-coil domain provides a potential structural paradigm for investigating YciC oligomerization .

What are the emerging research directions for Salmonella membrane proteins like YciC?

Future research on Salmonella typhimurium YciC and related membrane proteins is likely to advance in several key directions:

  • Structural Biology Integration: Combining cryo-electron microscopy with computational modeling to determine high-resolution structures of YciC in various oligomeric states and membrane environments.

  • Systems Biology Approaches: Mapping the complete interactome of YciC within the broader context of Salmonella membrane protein networks and virulence pathways.

  • Host-Pathogen Interface Studies: Investigating potential interactions between YciC and host cell components during infection, particularly in relation to colonization and immune evasion mechanisms.

  • Evolutionary Genomics: Analyzing YciC sequence and functional conservation across Salmonella serovars to understand adaptive roles in different host environments.

  • Therapeutic Target Potential: Evaluating YciC as a potential antivirulence target, particularly if structural studies reveal druggable pockets unique to bacterial proteins.

Research on related Salmonella membrane proteins has demonstrated connections between oligomeric state, energy metabolism, and virulence, suggesting similar multifunctional roles for YciC . Additionally, recent advances in understanding within-host Salmonella diversity highlight the importance of population-level approaches when studying membrane protein function in pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.