Recombinant Salmonella typhimurium UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella typhimurium UPF0266 Membrane Protein yobD (yobD)

The Recombinant Salmonella typhimurium UPF0266 membrane protein yobD (yobD) is a bioengineered version of the native yobD protein, a component of the UPF0266 family of uncharacterized membrane proteins in Salmonella typhimurium. This protein is encoded by the yobD gene (locus tag STM1833) and is expressed as a recombinant product in bacterial systems like E. coli or yeast for research and vaccine development purposes .

Comparisons with Other Salmonella Proteins

While yobD is distinct, its classification as a membrane protein aligns with well-studied Salmonella outer membrane porins like OmpA and OmpD, which are critical for virulence and host immune evasion . For example:

ProteinFunctionImmunogenicity
yobDUncharacterized; potential role in membrane transport or pathogenesisNot reported
OmpAOuter membrane porin; protects against nitrosative stress; virulence factor High
OmpDPorin; involved in antibiotic resistance and nutrient uptakeModerate

Expression Systems and Optimization

yobD is produced via recombinant DNA technology, with E. coli being the most common host due to cost-effectiveness and scalability . The protein is expressed in a Tris-based buffer with 50% glycerol for stability and stored at -20°C or -80°C .

Purification and Quality Control

  • Purity: Achieved through chromatography or affinity tagging (e.g., His-tag) .

  • Validation: SDS-PAGE confirms >85% purity, and mass spectrometry may verify sequence fidelity .

Immunoassay Tools

yobD is marketed for use in ELISA and Western blot to study Salmonella pathogenesis or immune responses . For example:

  • ELISA: Detects anti-yobD antibodies in serum or synovial fluid, aiding in diagnostics for reactive arthritis linked to Salmonella .

  • Western Blot: Validates recombinant protein expression and integrity .

Vaccine Candidate Potential

Though not directly tested in clinical trials, yobD is hypothesized as a candidate for subunit vaccines due to its membrane localization, a common target for immune recognition . This aligns with strategies used for other Salmonella antigens, such as InvH (a type III secretion system component), which showed 100% protection in murine models .

Unresolved Questions

  1. Function: yobD’s role in Salmonella pathogenesis or cellular processes remains undefined.

  2. Immunogenicity: No studies have directly assessed its ability to elicit protective immunity.

  3. Strain Variability: Differences in sequence length (1-156 vs. 1-152) across strains (e.g., S. typhimurium vs. S. enteritidis) may affect antigenicity .

Prioritized Research Areas

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve yobD’s topology.

  • Functional Screens: CRISPR-based knockout assays to link yobD to virulence traits.

  • Vaccine Efficacy: Preclinical trials to test yobD’s protective capacity in animal models.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yobD; STM1833; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQYLKI
Uniprot No.

Target Background

Database Links

KEGG: stm:STM1833

STRING: 99287.STM1833

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0266 membrane protein yobD?

UPF0266 membrane protein yobD is a bacterial membrane protein found in several species including Salmonella typhimurium and Escherichia coli. It belongs to the UPF (Uncharacterized Protein Family) 0266 classification, indicating that while its sequence is known, its precise function remains to be fully elucidated . The protein is encoded by the yobD gene and is expressed as a full-length protein consisting of 152-156 amino acids, depending on the specific bacterial strain .

How does the yobD protein sequence vary across bacterial species?

Comparative analysis of yobD protein sequences reveals both conservation and variation across bacterial species. The table below compares the sequences from Salmonella typhimurium and Escherichia coli O6:

SpeciesLengthUniProt IDKey Sequence Differences
Salmonella typhimurium156 aaQ8ZP01Contains "ALYDQ" in position 16-20; "TSHGAQMTTW" in positions 55-64
Escherichia coli O6152 aaP67602Contains "FAIYDQ" in position 16-21; "TNHGALITTW" in positions 55-65
Salmonella Heidelberg152 aaB4TKG4Identical to S. typhimurium in key regions

While these proteins share high sequence similarity (>90%), the key differences are primarily concentrated in the hydrophilic regions, potentially affecting protein-protein interactions or substrate specificity .

What are the optimal storage conditions for recombinant yobD protein?

Proper storage of recombinant yobD protein is critical for maintaining its structural integrity and biological activity. Based on manufacturer recommendations, the following protocols should be followed:

  • Long-term storage: Store at -20°C to -80°C in a Tris-based buffer with 50% glycerol .

  • Working aliquots: Store at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as they significantly degrade protein quality .

  • For reconstitution of lyophilized protein: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% before aliquoting for long-term storage .

These conditions have been optimized to preserve protein activity while minimizing degradation due to proteolysis or denaturation.

What expression systems are suitable for producing recombinant yobD?

Successful expression of membrane proteins like yobD requires careful consideration of expression systems. Based on the available research:

  • E. coli expression systems have proven effective for yobD production, as evidenced by commercial recombinant products .

  • The full-length protein (amino acids 1-152 or 1-156, depending on strain) can be successfully expressed with appropriate tags for purification .

  • His-tag fusion proteins appear to be particularly successful for yobD expression and purification .

When designing expression constructs, researchers should consider:

  • Codon optimization for the expression host

  • Signal sequences for proper membrane targeting

  • Fusion tags positioned to avoid interference with membrane insertion

  • Inducible promoters to control expression levels, as membrane protein overexpression can be toxic to cells

What is the predicted membrane topology of yobD?

Analysis of the yobD amino acid sequence suggests a characteristic membrane protein topology:

  • The protein contains multiple hydrophobic regions consistent with transmembrane domains.

  • The high proportion of hydrophobic amino acids (leucine, isoleucine, valine, phenylalanine) in segments such as "LVLILFIAALLAYA" and "VIFVGLVAILIYN" strongly suggests transmembrane helices .

  • The protein likely adopts a multi-pass membrane conformation with both N-terminal and C-terminal regions positioned in either the cytoplasm or periplasm.

A predicted topology model suggests:

  • 3-4 transmembrane helices

  • Short connecting loops between helices

  • Terminal domains that may facilitate interactions with other cellular components

What is the current understanding of yobD function in Salmonella?

  • Membrane localization indicates potential roles in:

    • Transport across the bacterial membrane

    • Signal transduction

    • Maintenance of membrane integrity

    • Interaction with host cells during infection

  • Sequence conservation across Salmonella strains suggests functional importance .

  • The presence of the protein in multiple pathogenic strains (Salmonella typhimurium, Salmonella Heidelberg) raises questions about potential roles in virulence or host adaptation.

Further experimental studies, including gene knockout analysis and protein-protein interaction studies, are needed to elucidate the specific function of yobD in Salmonella biology.

What experimental approaches can elucidate yobD function?

Researchers investigating yobD function can employ several complementary experimental approaches:

  • Gene Knockout and Complementation Studies:

    • Generate yobD deletion mutants in Salmonella

    • Assess phenotypic changes in growth, stress resistance, and virulence

    • Complement mutants with wild-type or mutated versions of yobD

  • Protein Interaction Studies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with epitope-tagged yobD

    • Crosslinking approaches to capture transient interactions

  • Structural Analysis:

    • Cryo-electron microscopy for membrane protein structure

    • X-ray crystallography (challenging for membrane proteins)

    • NMR studies of purified protein in membrane mimetics

  • Functional Assays:

    • Ion flux measurements if yobD functions in transport

    • Membrane integrity assessments

    • Host cell interaction studies

Each approach provides complementary information that, when integrated, can reveal the biological role of this uncharacterized membrane protein.

How can researchers optimize purification of recombinant yobD?

Purification of membrane proteins like yobD presents unique challenges. The following methodological approach is recommended:

  • Solubilization Optimization:

    • Screen detergents (DDM, LDAO, OG) for efficient solubilization

    • Test detergent:protein ratios to maximize yield

    • Consider native nanodiscs or styrene maleic acid copolymer approaches

  • Affinity Purification Strategy:

    • His-tagged constructs allow for IMAC purification

    • Optimize imidazole concentration in wash and elution buffers

    • Consider dual tag approaches (His-MBP, His-SUMO) for challenging constructs

  • Post-Purification Handling:

    • Detergent exchange or reconstitution into liposomes

    • Buffer optimization to maintain stability

    • Concentrate using centrifugal devices with appropriate molecular weight cutoffs

  • Quality Control:

    • SDS-PAGE to assess purity (>90% purity is achievable)

    • Size exclusion chromatography to assess monodispersity

    • Functional assays to confirm biological activity

This systematic approach maximizes the likelihood of obtaining pure, active yobD protein suitable for downstream applications.

What methods are suitable for studying yobD membrane localization?

Confirming and characterizing the membrane localization of yobD requires specialized techniques:

  • Membrane Fractionation:

    • Differential ultracentrifugation to separate cell fractions

    • Detergent-based separation of inner and outer membranes

    • Western blotting with anti-yobD antibodies to detect localization

  • Fluorescence Microscopy:

    • GFP/mCherry fusion constructs to visualize localization

    • Immunofluorescence with antibodies against native protein

    • Super-resolution microscopy for detailed subcellular localization

  • Protease Accessibility Assays:

    • Spheroplast preparation followed by protease treatment

    • Identification of protected fragments by mass spectrometry

    • Determination of topology based on cleavage patterns

  • Comparative Analysis:

    • Assessment of localization across different Salmonella strains

    • Evaluation under different growth conditions

    • Comparison with known membrane protein controls

These complementary approaches provide robust evidence for yobD membrane localization and topology.

How conserved is yobD across bacterial species?

The evolutionary conservation of yobD provides insights into its functional importance:

  • Sequence Conservation:

    • High conservation (>90% identity) between Salmonella strains

    • Significant homology (~80% identity) with E. coli homologs

    • Presence across Enterobacteriaceae family members

  • Structural Conservation:

    • Transmembrane domains show highest conservation

    • Terminal regions display greater sequence divergence

    • Key motifs are maintained across species

  • Genomic Context:

    • Analysis of neighboring genes may provide functional insights

    • Conservation of gene order across species suggests potential operonic structure

    • Potential co-evolution with interacting partners

This pattern of conservation suggests functional importance despite the current lack of characterized function.

What analytical techniques can resolve contradictory data about yobD function?

When researchers encounter contradictory data regarding yobD function, several analytical approaches can help resolve discrepancies:

  • Strain-Specific Differences:

    • Verify experiments use consistent strains (LT2, Heidelberg, etc.)

    • Compare sequence differences that might explain functional variation

    • Perform comparative functional assays across strains

  • Methodological Verification:

    • Implement switchback experimental designs to control for time-dependent effects

    • Utilize multiple complementary approaches to confirm findings

    • Carefully control for tag effects in recombinant protein studies

  • Conditional Functionality:

    • Assess function under varying environmental conditions

    • Test growth phase-dependent effects

    • Evaluate function in different media compositions

  • Data Integration:

    • Bayesian approaches to weigh evidence from multiple sources

    • Meta-analysis of published and unpublished datasets

    • Integration of computational predictions with experimental data

These approaches collectively provide a framework for resolving contradictory findings in yobD research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.