Recombinant Salmonella typhimurium UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella Typhimurium UPF0283 Membrane Protein YcjF

Recombinant Salmonella typhimurium UPF0283 membrane protein YcjF (Uniprot: Q8ZP64) is a 353-amino acid (aa) protein encoded by the ycjF gene (locus STM1684). This full-length membrane protein is classified under the UPF0283 family, which represents uncharacterized proteins with conserved domains across bacterial species . Its recombinant form is produced for research applications, including vaccine development and immunological studies, due to its potential as a target antigen in Salmonella infections .

Vaccine Development

The protein is explored as a candidate for subunit vaccines targeting Salmonella infections. Its immunogenic properties are leveraged to stimulate protective immune responses, particularly in serovars like S. typhimurium (strain LT2) and Salmonella newport (strain SL254) .

Diagnostic Tools

Recombinant YcjF is used in enzyme-linked immunosorbent assays (ELISA) to detect anti-Salmonella antibodies. These kits employ the full-length protein (50 µg per vial) to ensure high specificity .

Comparative Analysis of Recombinant YcjF Preparations

Product CodeSource OrganismStrainTagPurityApplication
RFL6097SFS. typhimuriumLT2N-terminal His>85%General Research
CSB-MP509990ENU1E. coliK12/MC4100/BW2952Undetermined>85%Partial Protein
VAng-Wyb0703S. typhimuriumLT2His-tag>85%Vaccine Development
VAng-Wyb0702Salmonella newportSL254His-tag>85%Vaccine Development

Note: E. coli-derived YcjF (CSB-MP509990ENU1) is a distinct homolog and not directly comparable to S. typhimurium variants .

Stability and Handling

Repeated freezing/thawing is discouraged, with working aliquots stored at 4°C for ≤1 week . The protein’s stability in glycerol-containing buffers ensures long-term viability for experimental use .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycjF; STM1684; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGAAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links

KEGG: stm:STM1684

STRING: 99287.STM1684

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YcjF protein and how is it classified?

YcjF in Salmonella typhimurium is classified as a UPF0283 membrane protein containing the DUF892 domain, which belongs to the ferritin-like superfamily . This classification suggests potential roles in iron metabolism and stress response mechanisms. The protein is membrane-associated, indicating integration into or association with bacterial cell membranes. Studies of related proteins show it likely functions in protecting bacteria from oxidative stress by managing iron homeostasis .

What is the relationship between YciF and YcjF proteins in Salmonella?

YciF and YcjF appear to be related proteins in Salmonella with potentially overlapping functions. While YciF has been characterized as an iron-binding protein with ferroxidase activity involved in stress responses, YcjF likely shares similar functional characteristics but may differ in specific regulatory patterns or cellular localization . Based on current research, YciF has been demonstrated to sequester excess iron in the cellular environment to counter ROS-associated cell death, suggesting YcjF may have comparable protective roles .

How does YcjF's structure relate to its function?

The YcjF protein likely contains multiple metal binding sites within its DUF892 domain that are crucial for its function. Based on studies of YciF, these sites coordinate iron ions to facilitate ferroxidase activity (oxidation of Fe²⁺ to Fe³⁺), which prevents iron from participating in reactions that generate harmful reactive oxygen species . The protein forms higher-order oligomers, creating a structure that optimizes iron sequestration and detoxification in the bacterial cell .

What are the key metal binding sites in YcjF and their significance?

Based on research with related proteins, YcjF likely contains at least two critical metal binding sites within its DUF892 domain. Studies on YciF identified specific residues (corresponding to positions Q54, E113, and E143) that coordinate metal binding and are essential for ferroxidase activity . Mutations at these sites (Q54A, E113Q, and E143D) significantly compromised the protein's ability to bind iron and protect against oxidative stress, demonstrating their functional importance . The site E143 appears to be particularly crucial as it serves as a bridging ligand between multiple metal binding sites .

MutationTarget SiteEffect on ProteinFunctional Impact
Q54AM2 binding siteSimilar stability to wild-typeCompromised ferroxidase activity
E113QM1 binding siteSimilar stability to wild-typeCompromised ferroxidase activity
E143DBridging ligand for both sitesDecreased stability (Tm = 53.5°C)Severe impairment of function

How does YcjF contribute to bacterial stress responses?

YcjF likely plays a critical role in bacterial stress responses, particularly against oxidative and bile stress. Research on YciF demonstrates that these proteins help combat iron toxicity and oxidative damage by sequestering excess iron that would otherwise participate in Fenton reactions . This function becomes especially important during exposure to stressors like bile, which can disrupt iron homeostasis and increase reactive oxygen species (ROS) generation . YcjF's ferroxidase activity helps maintain redox balance in the cell, preventing damage to cellular components and enhancing bacterial survival under stress conditions .

What are the optimal expression systems for recombinant YcjF production?

For optimal recombinant YcjF production, E. coli-based expression systems typically yield the best results for bacterial membrane proteins. Based on current practices for similar proteins, BL21(DE3) strains or specialized derivatives like C41(DE3) designed to handle membrane protein toxicity are recommended. Expression conditions should be carefully optimized with lower induction temperatures (16-25°C), moderate inducer concentrations, and extended expression times to balance yield with proper folding. The protein may be expressed with purification tags such as His-tag or Strep-tag, with the tag placement (N or C-terminal) requiring optimization to avoid interference with protein folding or function .

What purification strategy yields the highest purity and activity for YcjF?

A multi-step purification strategy is recommended for obtaining high-purity, active YcjF:

  • Cell lysis using methods that preserve membrane integrity (e.g., French press or sonication with cooling)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization with appropriate detergents (DDM, LDAO, or Triton X-100)

  • Affinity chromatography using streptactin resin for Strep-tagged protein

  • Size exclusion chromatography to separate oligomeric states and remove aggregates

  • Quality assessment via SDS-PAGE, thermal shift assay (to confirm stability), and activity assays

Storage in 50% glycerol in Tris-based buffer at -20°C helps maintain stability, with working aliquots kept at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to preserve activity .

How can the ferroxidase activity of YcjF be accurately measured?

Ferroxidase activity of YcjF can be measured using several complementary approaches:

Assay TypeMethodologyData InterpretationControls
SpectrophotometricMonitor Fe³⁺ formation at 310nmIncrease in absorbance correlates with ferroxidase activitySite-specific mutants (Q54A, E113Q, E143D) as negative controls
Oxygen ConsumptionClark-type electrode measuring O₂ uptakeRate of O₂ consumption proportional to ferroxidase rateHeat-inactivated protein as negative control
Ferrozine-basedMeasure Fe²⁺ disappearance via ferrozine complex (562nm)Decrease in absorbance indicates Fe²⁺ oxidationIron-binding compounds (EDTA) as positive control
ROS ProtectionMeasure protection against H₂O₂-induced damageCorrelate ferroxidase activity with cellular protectionWild-type vs. ΔycjF strains under oxidative stress

Results should be analyzed in context of protein concentration, iron availability, and environmental conditions (pH, temperature) to fully characterize the enzyme kinetics .

What methods are appropriate for studying YcjF's role in stress responses?

To comprehensively investigate YcjF's role in stress responses, researchers should employ:

  • Gene deletion and complementation studies comparing wild-type, ΔycjF, and complemented strains under various stress conditions (bile, oxidative stress, iron limitation/excess)

  • Transcriptional analysis using qRT-PCR or RNA-seq to measure ycjF expression patterns under different stresses

  • ROS measurement assays using fluorescent probes (e.g., DCFH-DA) to quantify intracellular reactive oxygen species levels

  • Iron homeostasis assessment using colorimetric assays or ICP-MS to measure intracellular iron content

  • Protein-protein interaction studies using pull-down assays or bacterial two-hybrid systems to identify stress response network components that interact with YcjF

  • In vivo infection models to assess the contribution of YcjF to bacterial survival during host colonization

How does YcjF contribute to Salmonella pathogenesis?

YcjF likely contributes to Salmonella pathogenesis through several mechanisms related to stress adaptation during infection:

  • Protection against host-derived stress factors, particularly bile and oxidative stress encountered during gastrointestinal transit and within macrophages

  • Maintenance of iron homeostasis in the iron-limited environment of the host, preventing both iron starvation and toxicity

  • Prevention of ROS-associated cell death, enhancing bacterial survival in inflammatory environments

  • Possible roles in biofilm formation or other virulence mechanisms, similar to how YajC (another bacterial membrane protein) contributes to biofilm formation and virulence in Enterococcus faecium

Research suggests that proteins involved in iron management and oxidative stress protection, like YcjF, are often critical virulence determinants as they help bacteria adapt to the hostile host environment .

What is the relationship between YcjF and the bacterial iron regulatory network?

YcjF likely interfaces with the broader bacterial iron regulatory network, particularly systems involved in:

  • Iron sensing and responsive gene regulation (potentially influenced by Fur or similar regulators)

  • Iron uptake and storage systems that maintain appropriate intracellular iron levels

  • Oxidative stress response pathways, as iron management and ROS detoxification are tightly linked

  • Membrane integrity maintenance, especially during exposure to membrane-disrupting agents like bile

The relationship appears bidirectional, with iron regulatory networks likely controlling ycjF expression, while YcjF activity influences the cellular iron status and consequent regulatory responses . This places YcjF as part of a complex adaptive network rather than an isolated component of stress response.

How does YcjF compare with other bacterial iron-binding proteins?

YcjF represents a distinct class of bacterial iron-binding proteins with unique properties:

Protein FamilyCellular LocationIron Binding CapacityPrimary FunctionStructural Features
YcjF (DUF892)Membrane-associatedModerate (based on YciF)Iron detoxification, ROS protectionMetal binding sites within DUF892 domain, forms oligomers
Ferritins (Ftn)CytoplasmicHigh (up to 4500 Fe atoms)Iron storage24-subunit spherical cage
Bacterioferritins (Bfr)CytoplasmicHigh (up to 4500 Fe atoms)Iron storage24-subunit spherical cage with heme groups
Dps proteinsNucleoid-associatedModerate (up to 500 Fe atoms)DNA protection, iron sequestration12-subunit cage
Siderophore receptorsOuter membraneLow (transport, not storage)Iron acquisitionβ-barrel structure with plug domain

YcjF's membrane association and moderate iron-binding capacity suggest a specialized role in local iron management at the membrane-cytoplasm interface, potentially protecting membrane components from iron-catalyzed oxidative damage .

What potential exists for YcjF as a therapeutic target?

YcjF presents several characteristics that make it an attractive potential therapeutic target:

  • As a membrane protein involved in stress responses, it may be accessible to inhibitors and critical for bacterial survival under host conditions

  • Its role in iron homeostasis offers possibilities for disrupting bacterial metal metabolism, a vital process for pathogens

  • The wide distribution of the DUF892 domain across bacterial pathogens suggests potential for broad-spectrum approaches

  • The unique features of bacterial iron metabolism proteins compared to host proteins could allow for selective targeting

  • Inhibition might synergize with existing antibiotics by compromising bacterial stress responses

Development of YcjF inhibitors would require detailed structural information, which could be obtained through X-ray crystallography or cryo-electron microscopy, followed by structure-based drug design approaches .

What are the current limitations in understanding YcjF function?

Several significant knowledge gaps remain in our understanding of YcjF:

  • Limited structural information specifically for YcjF from Salmonella typhimurium, though inferences can be made from related proteins

  • Incomplete characterization of its precise physiological role compared to other stress response proteins

  • Uncertain regulatory mechanisms controlling its expression under different conditions

  • Limited knowledge of potential interaction partners or complexes formed with other bacterial proteins

  • Unclear relationship between its membrane association and its iron-binding/ferroxidase activities

  • Insufficient data on its importance across different phases of infection or in different host niches

These limitations present opportunities for focused research efforts to better characterize this important protein.

How might structural studies of YcjF inform drug development?

Structural studies of YcjF could significantly advance therapeutic development through:

  • Revealing the precise configuration of metal binding sites, enabling design of competitive inhibitors

  • Identifying potential allosteric sites that could be targeted to modify protein function

  • Elucidating membrane interaction domains that could be blocked to disrupt localization

  • Providing insights into oligomerization interfaces that could be targeted to prevent functional assembly

  • Facilitating structure-based virtual screening of compound libraries to identify initial hit compounds

Such studies would require production of high-quality protein samples suitable for techniques such as X-ray crystallography, similar to those used to determine the crystal structure of YciF that revealed its two metal binding sites .

What novel research directions could advance our understanding of YcjF?

Promising research directions to enhance our understanding of YcjF include:

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics to place YcjF in broader cellular networks

  • Single-cell analyses to capture potential heterogeneity in YcjF expression and function within bacterial populations

  • Comparative studies across multiple Salmonella serovars and related pathogens to understand evolutionary conservation and divergence

  • Investigation of potential synergistic interactions between YcjF and other stress response systems

  • Development of chemical probes specifically targeting YcjF to validate its importance in various infection models

  • Exploration of potential roles beyond iron metabolism, such as in biofilm formation or cellular signaling pathways

  • Examination of host immune responses to YcjF and potential as a vaccine candidate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.