Recombinant Salmonella typhimurium UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for optimal storage.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is assigned during production. If you require a particular tag, please inform us; we will prioritize development of your specified tag.
Synonyms
yjjB; STM4545; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: stm:STM4545

STRING: 99287.STM4545

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Salmonella typhimurium UPF0442 protein yjjB?

Salmonella typhimurium UPF0442 protein yjjB belongs to the uncharacterized protein family UPF0442. It is a 157-amino acid protein that is predicted to be membrane-associated based on its amino acid sequence characteristics. Despite being categorized as an uncharacterized protein, sequence analysis suggests it may function in membrane transport or signaling processes. Recombinant versions are typically expressed with tags (such as His-tag) to facilitate purification and experimental manipulation in research settings .

What expression systems are commonly used for recombinant yjjB production?

Recombinant yjjB protein is typically expressed in E. coli expression systems. This approach offers several advantages:

Expression SystemAdvantagesConsiderations
E. coli- High yield
- Cost-effective
- Rapid growth
- Well-established protocols
- Potential inclusion body formation
- Possible endotoxin contamination
- Limited post-translational modifications

The expression typically involves adding an N-terminal His-tag to facilitate subsequent purification steps. For research applications, it's important to optimize expression conditions including temperature, induction time, and media composition to maximize soluble protein yield .

What are the recommended storage and handling protocols for recombinant yjjB?

Proper storage and handling are critical for maintaining protein stability and activity. For recombinant yjjB protein, the following protocols are recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, reconstituted protein should be supplemented with glycerol (5-50% final concentration) and stored at -20°C/-80°C

  • The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity.

What is the proper reconstitution method for lyophilized yjjB protein?

The reconstitution of lyophilized yjjB protein should follow these methodological steps to ensure optimal protein recovery and activity:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

  • Validate protein integrity after reconstitution using techniques such as SDS-PAGE

This methodological approach ensures that the protein maintains its structural integrity and functional properties for subsequent experimental applications.

How can Design of Experiments (DoE) methodology be applied to optimize yjjB purification?

Design of Experiments (DoE) is a powerful statistical approach that can significantly improve recombinant protein purification protocols, including for proteins like yjjB. A systematic DoE approach for yjjB purification optimization would involve:

  • Factor identification: Identify critical parameters affecting purification yield and purity, such as:

    • Heat treatment temperature (e.g., 70-90°C)

    • Heat treatment duration (e.g., 15-60 minutes)

    • Column loading volume/concentration

    • Buffer additives and their concentrations

  • Experimental design: Create a factorial or response surface design to efficiently test combinations of factors with minimal experiments.

  • Response measurement: Define appropriate response variables (yield, purity) and analytical methods to measure them.

  • Statistical analysis: Use statistical software to identify significant factors and interactions, develop predictive models, and identify optimal conditions.

For example, a DoE study might reveal that heat treatment temperature and additive concentration are the most critical factors affecting yield, while heat treatment time and column loading have less impact. The analysis might identify important interaction effects, such as between temperature and additives.

Based on DoE modeling, optimal conditions can be predicted. For instance, if heat temperature is set to 90°C and additive concentration to 0.5%, the model might predict a yield of 17.3 mg of purified protein .

What experimental approaches are recommended to characterize the function of uncharacterized proteins like yjjB?

Characterizing uncharacterized proteins like yjjB requires a multi-faceted experimental approach:

ApproachMethodologyExpected Outcome
Structural AnalysisX-ray crystallography, NMR, Cryo-EMThree-dimensional structure revealing potential functional domains
Sequence-Based PredictionsBioinformatic analysis, homology modelingPredictions of functional domains, transmembrane regions, and evolutionary relationships
Protein-Protein InteractionsPull-down assays, yeast two-hybrid, co-immunoprecipitationIdentification of interaction partners suggesting functional pathways
Gene Expression AnalysisRNA-seq, qPCR under various conditionsUnderstanding of regulatory patterns and conditions triggering expression
Gene Deletion/MutationCRISPR-Cas9, targeted mutagenesisPhenotypic effects revealing functional importance
Localization StudiesFluorescent tagging, subcellular fractionationCellular localization providing functional clues
Biochemical AssaysSubstrate binding, enzymatic activity testsDirect functional characterization

For membrane proteins like yjjB, additional approaches include membrane reconstitution studies and transport assays to assess potential roles in membrane translocation processes. Rational protein design approaches, as described in the literature, can also be valuable for testing hypotheses about structure-function relationships .

What quality control methods should be implemented for recombinant yjjB production?

Ensuring the quality and consistency of recombinant yjjB requires rigorous quality control methods:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target >90% purity)

    • Western blotting with anti-His antibodies to confirm identity

    • HPLC or capillary electrophoresis for higher resolution purity analysis

  • Structural Integrity:

    • Mass spectrometry to verify the exact molecular weight and sequence coverage

    • Circular dichroism to assess secondary structure elements

    • Thermal shift assays to evaluate protein stability

  • Functional Validation:

    • Activity assays (if known function) or surrogate binding assays

    • In vitro reconstitution in membrane mimetics for membrane proteins

    • Native PAGE to assess oligomeric state

  • Contaminant Analysis:

    • Endotoxin testing (especially important for E. coli-expressed proteins)

    • Host cell protein quantification

    • DNA contamination assessment

  • Batch Consistency:

    • Lot-to-lot comparison using established analytical methods

    • Reference standard comparison

Documentation of these quality control measures is essential for research reproducibility and should be included in materials and methods sections of publications .

How can rational protein design principles be applied to study yjjB structure-function relationships?

Rational protein design offers powerful approaches to investigate structure-function relationships in proteins like yjjB. This methodology follows the "design cycle" principle, where theory and experiment alternate to progressively build understanding:

  • Initial Structural Analysis:

    • Use bioinformatic tools to predict secondary structure elements and potential functional domains

    • Identify conserved residues through multiple sequence alignments

    • Develop molecular models based on homology or de novo approaches

  • Hypothesis Generation:

    • Formulate specific hypotheses about the roles of particular amino acids or domains

    • Design targeted mutations to test these hypotheses

  • Progressive Design Strategy:

    • Begin with the simplest possible designs (single mutations)

    • Iteratively introduce more complex modifications

  • Experimental Testing:

    • Express and purify the designed variants

    • Analyze their properties through structural and functional assays

    • Compare with the wild-type protein

  • Refinement:

    • Based on experimental outcomes, refine hypotheses and models

    • Design the next iteration of experiments

This approach allows researchers to identify "minimally sufficient" sets of components that determine protein function. For membrane proteins like yjjB, particular attention should be paid to transmembrane domains, potentially designing chimeric proteins or specific mutations in these regions to elucidate their role in membrane association and function .

What are the technical considerations when working with His-tagged yjjB?

Working with His-tagged yjjB requires attention to several technical considerations that can impact experimental outcomes:

  • Tag Position Effects:

    • N-terminal His-tags (as used in commercial yjjB preparations) may affect protein folding differently than C-terminal tags

    • For membrane proteins, tag position can interfere with membrane insertion or topology

  • Purification Optimization:

    • Nickel or cobalt affinity chromatography conditions need optimization (imidazole concentration, pH, salt)

    • Consider two-step purification for higher purity (affinity followed by ion exchange or size exclusion)

  • Tag Interference in Functional Studies:

    • His-tags can potentially alter protein-protein interactions or enzymatic activity

    • Control experiments with tag-cleaved protein may be necessary for critical functional studies

  • Protein Solubility:

    • His-tags can sometimes improve solubility, but may also promote aggregation in some cases

    • Buffer optimization may be required (detergents for membrane proteins like yjjB)

  • Artificial Dimerization:

    • His-tags can promote artificial dimerization through metal ion bridging

    • Include EDTA in buffers post-purification if this is a concern

  • Detection Methods:

    • Anti-His antibodies provide an alternative detection method

    • Direct detection via the tag can confirm expression when protein-specific antibodies are unavailable

These considerations should be addressed during experimental design and discussed in publications to ensure reproducibility and proper interpretation of results .

What ethical and safety considerations apply to research with Salmonella typhimurium proteins?

Research involving Salmonella typhimurium proteins, including yjjB, necessitates careful attention to ethical and safety considerations:

  • Biosafety Levels:

    • While recombinant proteins themselves typically don't require high biosafety levels, work with live Salmonella typhimurium requires BSL-2 facilities

    • Institutional biosafety committee approval may be needed depending on the research scope

  • Research Participant Protection:

    • Studies involving human subjects (even for antibody generation) require ethical review

    • Informed consent must address confidentiality protections and potential risks

    • Certificates of Confidentiality may be needed to protect sensitive research data

  • Data Security and Confidentiality:

    • Implement appropriate data security measures, particularly for research with potential dual-use applications

    • Clear protocols for data sharing and storage should be established

  • Product Safety Labeling:

    • Recombinant proteins should be clearly labeled as "Not For Human Consumption"

    • Safety data sheets should accompany all research materials

  • Waste Management:

    • Proper disposal of biological materials according to institutional and regulatory guidelines

    • Special considerations for potentially contaminated materials

  • Research Integrity:

    • Transparent reporting of methods and results

    • Proper citation of material sources and methodologies

Addressing these considerations is essential not only for regulatory compliance but also for maintaining the highest standards of research ethics and integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.