Recombinant Salmonella typhimurium UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests as much as possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
yihY; STM4027; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGVSLAISSYLLSLRWASDLNTVIDNV LHILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links

KEGG: stm:STM4027

STRING: 99287.STM4027

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YihY protein in Salmonella typhimurium and what is its genomic context?

YihY is a membrane protein belonging to the UPF0761 family found in Salmonella typhimurium. The protein is part of the yih operon, which plays significant roles in bacterial survival and virulence . Research indicates that the yihU-yshA gene cluster, which includes yihY, forms a transcriptional unit that is positively regulated by the cAMP receptor protein (CRP) . This operon has been implicated in Salmonella survival in the gallbladder and appears to be carbon catabolite-repressed in Salmonella, indicating it forms part of the CRP regulon in enteric bacteria .

To study this protein in its genomic context, researchers typically employ comparative genomic analyses and transcriptomic approaches to understand its regulation and expression patterns in different environmental conditions.

What experimental systems are available to study recombinant YihY protein?

Several experimental systems are available for studying the recombinant YihY protein:

  • E. coli expression systems: The full-length YihY protein can be expressed in E. coli with fusion tags (such as His-tags) for purification and analysis .

  • Recombinant attenuated Salmonella vaccine (RASV) platforms: These systems can be adapted to express and study membrane proteins like YihY in the context of vaccine development .

  • Lambda red recombination methods: This technique has been used to generate deletion mutants (e.g., ΔyihO, ΔyihQ) to study the effects of gene knockouts on phenotypes .

  • Structural analysis techniques: Methods including evolutionary co-variation analysis, lipid-versus-protein-exposure analysis, and molecular dynamics simulations have been employed to study membrane protein structures .

For optimal research outcomes, it is recommended to express the protein with appropriate tags and purify under conditions that maintain the native conformation of membrane proteins.

How does the yih operon contribute to Salmonella virulence and survival?

Recent research has revealed that the yih operon, which includes yihY, plays crucial roles in Salmonella virulence and survival:

  • O-antigen capsule formation: The yihO and yihQ genes in the yih operon are associated with O-antigen capsule formation, which is critical for bacterial surface integrity .

  • Environmental stress response: Deletion of yihO and yihQ results in impaired bacterial fitness, including reduced ability to withstand starvation and environmental stressors .

  • Biofilm formation and motility: Bacterial fitness screening of ΔyihO, ΔyihQ, and ΔyihO/Q mutants showed significant impairment in biofilm formation and motility .

  • Intracellular survival: In vitro studies using phagocytic and non-phagocytic cells revealed that deletion mutants, particularly ΔyihO and ΔyihO/Q, show decreased bacterial invasion and intracellular replication .

  • In vivo colonization: The ability of these mutants to proliferate in vivo was significantly reduced, as observed in liver and spleen colonization studies .

These findings suggest that the yih operon, including yihY, is essential for maintaining Salmonella's environmental resilience and virulence capabilities.

How is the expression of yihY regulated in Salmonella?

The expression of yihY is subject to complex regulatory mechanisms:

  • cAMP Receptor Protein (CRP) regulation: Research has shown that the yihU-yshA gene cluster, which includes yihY, is positively regulated by the global regulator CRP .

  • Carbon catabolite repression: The yihU-yshA transcriptional unit is carbon catabolite-repressed in Salmonella, indicating that carbon source availability influences its expression .

  • CRP binding sites: Two CRP-binding sites on the regulatory region of the yihU-yshA operon are required to promote transcriptional activation .

  • Potential quorum sensing involvement: Given that SdiA (the quorum sensing regulator of Salmonella) is a key element in triggering the expression of virulence factors, it may also play a role in regulating yihY expression under certain conditions .

To study these regulatory mechanisms, researchers typically employ techniques such as reporter gene assays, DNA-protein binding assays, and transcriptomic analyses under different environmental conditions.

What structural prediction methods can be applied to study membrane proteins like YihY?

Advanced structural prediction methods for membrane proteins like YihY include:

  • Evolutionary co-variation analysis: This approach identifies amino acid pairs that co-evolve, suggesting proximity in the three-dimensional structure. The technique has been successfully applied to membrane proteins like YidC .

  • Rosetta co-evolution-guided structure prediction: This method combines co-evolutionary information with the Rosetta structure prediction software to generate high-accuracy models of proteins without detectable sequence similarity to known structures .

  • Molecular dynamics (MD) simulations: MD simulations can assess the stability and biochemical properties of predicted protein structures in the bacterial membrane, identifying key stabilizing residues and interactions .

  • Lipid-versus-protein-exposure analysis: This technique helps determine which regions of the protein are exposed to lipids versus those that interact with other proteins .

  • In vivo complementation assays: These can verify the functional relevance of residues suggested by computational models .

For membrane proteins like YihY, models can be validated through:

  • Assessment of stability in simulated membrane environments

  • Analysis of inter-residue interactions within transmembrane regions

  • Site-directed mutagenesis of predicted key residues followed by functional assays

What transcriptomic changes occur when yihY or related genes are deleted in Salmonella?

Transcriptomic analysis of Salmonella mutants with deletions in the yih operon reveals significant changes in gene expression patterns:

  • Downregulation of virulence genes: Transcriptome analysis of the ΔyihO mutant revealed downregulation of several genes associated with key processes such as flagellar assembly, Salmonella infection, and T3SS protein secretion, including SPI-1 and SPI-2 genes .

  • Impact on stress response pathways: Genes involved in responding to environmental stressors may be differentially expressed in these mutants.

  • Effect on metabolic pathways: Changes in the expression of genes involved in various metabolic processes might be observed.

The methodology to study these transcriptomic changes typically involves:

  • RNA-Seq analysis of wild-type and mutant strains

  • Differential gene expression analysis

  • Pathway enrichment analysis

  • Validation of key differentially expressed genes through qRT-PCR

How can recombinant YihY protein be used in vaccine development strategies?

Recombinant YihY protein could potentially be incorporated into vaccine development strategies through several approaches:

  • Recombinant live-attenuated Salmonella vaccines (RASVs): The YihY protein could be expressed in attenuated Salmonella strains designed to deliver protective antigens. RASVs have shown promise in providing long-term immunity against bacterial, viral, and parasitic pathogens .

  • Balanced lethal systems: These systems ensure the stability of plasmid vectors encoding protective antigens post-immunization, which could be applied to YihY-based vaccines .

  • Multiple administration routes: Studies with RASVs have shown effective immune responses across intramuscular, nasal, and oral routes, providing flexibility in tailoring vaccine strategies .

To develop such vaccines, researchers would need to:

  • Optimize expression of YihY in attenuated Salmonella strains

  • Evaluate immunogenicity through measurement of both humoral and cellular immune responses

  • Assess protection against challenge with virulent Salmonella

  • Determine the optimal delivery route and dosing schedule

What methodologies are most effective for studying YihY protein-host cell interactions?

To study YihY protein-host cell interactions, researchers can employ several complementary methodologies:

  • Cell invasion assays: Using both phagocytic and non-phagocytic cell lines to assess the impact of YihY on bacterial entry and survival .

  • Fluorescence microscopy: To visualize the localization of YihY during host cell interactions and infection processes.

  • Immunoprecipitation and pull-down assays: To identify potential host cell binding partners of YihY.

  • ELISA and other binding assays: To quantify direct interactions between purified YihY and candidate host receptors.

  • Cytokine production assays: To measure inflammatory responses triggered by YihY, such as TNF-α induction .

  • Animal models: To evaluate the role of YihY in colonization and persistence in vivo, as has been done with other Salmonella virulence factors .

These methods should be combined with appropriate controls, including YihY deletion mutants and complemented strains, to establish specificity of observed effects.

How does YihY contribute to Salmonella's ability to evade host immune responses?

The contribution of YihY to Salmonella's immune evasion strategies can be studied through several approaches:

  • Complement resistance assays: Other membrane proteins in Salmonella have been shown to confer resistance to complement killing , and YihY might have similar properties.

  • Macrophage survival studies: Assessing intracellular survival and replication within macrophages for wild-type and YihY mutant strains .

  • Cytokine response measurement: Determining whether YihY affects the production of inflammatory cytokines like TNF-α, which plays a critical role in host defense against Salmonella .

  • ROS resistance testing: Evaluating if YihY contributes to bacterial resistance against reactive oxygen species produced by immune cells.

  • In vivo imaging: Using bioluminescent reporter strains to track the dissemination and persistence of YihY-expressing versus YihY-deficient Salmonella in animal models.

Current research suggests that genes in the yih operon play important roles in stress resistance and intracellular survival , indicating that YihY may contribute to these phenotypes through mechanisms that warrant further investigation.

What techniques are available for analyzing protein-protein interactions involving YihY?

Several sophisticated techniques can be employed to analyze protein-protein interactions involving the YihY membrane protein:

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these can identify potential interacting partners within the bacterial cell.

  • Cross-linking coupled with mass spectrometry: This approach can capture and identify transient interactions between YihY and other proteins in their native environment.

  • Co-immunoprecipitation with membrane-specific detergents: To preserve membrane protein interactions while allowing effective pull-down of complexes.

  • Surface plasmon resonance (SPR): For quantitative assessment of binding kinetics between purified YihY and candidate interacting proteins.

  • Fluorescence resonance energy transfer (FRET): To visualize protein interactions in living cells.

  • Co-evolutionary analysis: As demonstrated with other membrane proteins, this computational approach can predict potential interaction interfaces based on patterns of evolutionary conservation .

When designing these experiments, it's important to consider the membrane environment of YihY and use appropriate controls to distinguish specific from non-specific interactions.

How might structural information about YihY inform new antimicrobial development strategies?

Structural information about YihY could inform antimicrobial development in several ways:

  • Identification of druggable pockets: Detailed structural analysis could reveal potential binding sites for small molecule inhibitors.

  • Structure-based drug design: Once the three-dimensional structure is known, computational approaches can be used to screen virtual compound libraries for potential inhibitors.

  • Epitope mapping: Structural data can help identify surface-exposed regions that might serve as targets for antibody-based therapeutics.

  • Membrane disruption strategies: Understanding how YihY integrates into the membrane could inform the development of peptides or other agents that disrupt membrane integrity.

  • Vaccine antigen design: Structural information could guide the selection of immunogenic epitopes for subunit vaccine development.

The approaches used for structural determination of other membrane proteins, such as evolutionary co-variation analysis and molecular dynamics simulations , could be applied to YihY to generate this valuable structural information.

What is the relationship between YihY and Salmonella pathogenicity islands?

The relationship between YihY and Salmonella pathogenicity islands (SPIs) represents an important area for investigation:

  • Transcriptomic evidence: Recent studies have shown that deletion of yihO (in the same operon as yihY) results in downregulation of genes associated with SPI-1 and SPI-2, which are critical for Salmonella invasion and intracellular survival .

  • Potential regulatory interactions: YihY might participate in regulatory networks that influence the expression of SPI genes.

  • Coordinated function: YihY may work in concert with SPI-encoded virulence factors to facilitate bacterial invasion and survival.

  • Alternative entry pathways: While SPI-1 encodes the T3SS-1 invasion system, Salmonella also possesses alternative entry mechanisms like those mediated by outer membrane proteins . YihY could potentially contribute to these alternative pathways.

Research methodologies to explore these relationships could include:

  • Transcriptomic analysis of wild-type and yihY mutant strains under SPI-inducing conditions

  • Protein-protein interaction studies between YihY and SPI-encoded proteins

  • Phenotypic characterization of double mutants lacking both yihY and key SPI components

What comparative genomic approaches can reveal the evolution and conservation of YihY across bacterial species?

Comparative genomic approaches can provide valuable insights into the evolution and conservation of YihY:

  • Phylogenetic analysis: Constructing phylogenetic trees based on YihY sequences from different bacterial species to understand evolutionary relationships.

  • Synteny analysis: Examining the conservation of gene order around yihY across different bacterial genomes to identify conserved operonic structures.

  • Selection pressure analysis: Calculating dN/dS ratios to determine whether YihY is under purifying, neutral, or positive selection.

  • Domain architecture comparison: Identifying conserved functional domains and their arrangement across different bacterial species.

  • Co-evolutionary analysis: As used for other membrane proteins , this approach can identify co-evolving residues that may be functionally or structurally important.

These approaches can help determine:

  • The core conserved regions of YihY that likely perform essential functions

  • Species-specific adaptations that might relate to host range or environmental niches

  • Potential horizontal gene transfer events involving yihY

  • The evolutionary history of the yih operon as a whole

Table of Research Findings on YihY and Related Proteins

Protein/GeneOrganismFunction/RoleResearch MethodKey FindingsReference
YihYS. typhimuriumUPF0761 membrane proteinTranscriptomicsPart of yih operon involved in virulence
YihO/YihQS. typhimuriumO-antigen capsule formationGene deletion, phenotypic screeningDeletion impairs biofilm formation, motility, stress survival
YihU-YshAS. typhiSurvival in gallbladderTranscriptional analysisRegulated by cAMP receptor protein (CRP)
YidCE. coliMembrane protein insertaseEvolutionary co-variation analysis, MD simulationsStructural model with distinctive arrangement of transmembrane domains
Recombinant attenuated Salmonella vaccinesVarious Salmonella strainsVaccine vectorsImmunological assaysEffective induction of humoral and cellular immune responses
ΔyjeKS. typhimuriumAttenuated vaccine candidateAnimal experimentsProtected mice against invasive Salmonella infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.