Recombinant Salmonella typhimurium Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

ZntB is involved in zinc transport, and its activity is stimulated by a pH gradient across the membrane . ZntB likely mediates $$Zn^{2+}/H^+$$ co-transport, functioning as an importer for zinc . Mutations in zntB result in hypersensitivity to the cytotoxic effects of zinc, which suggests a role in zinc efflux . ZntB cannot function as a $$Mg^{2+}$$ uptake pathway .

Transport Mechanism

ZntB mediates $$Zn^{2+}$$ uptake, which is stimulated by a pH gradient across the membrane . The transport mechanism of ZntB differs from that of the homologous CorA $$Mg^{2+}$$ channels .

Role in Zinc Homeostasis and Stress Response

ZntA and ZitB are the primary zinc efflux systems in S. Typhimurium . ZntA and ZitB are required for S. Typhimurium resistance to nitrosative stress . The absence of ZntA and ZitB results in increased levels of free intracellular zinc .

Genetic and Molecular Studies

FeatureDescription
GenezntB
FunctionTransmembrane zinc transport
Phenotype of MutantsHypersensitivity to zinc
ComplementationTransport deficiency can be complemented by a plasmid encoding a wild-type zntB allele
HomologyCorA $$Mg^{2+}$$ transport protein

ZntB in Different Bacterial Species

ZntB is found in the protobacteria of the α-, β-, and γ-subgroups . ZntB homologues appear to be the only 2-TM-GxN type protein specified by the genomes of Silicibacter pomeroyi, Idiomarina loihiensis, the Vibrio group, and the isolated proteobacterial genus Magnetococcus . In these bacterial species, CorA orthologs are apparently lacking .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; STM1656; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Gene References Into Functions
  1. Structural analyses (crystallography) and isothermal titration calorimetry data reveal three Zn2+ binding sites in full-length ZntB; two are potentially involved in Zn2+ transport. See: PMID: 21565704
Database Links

KEGG: stm:STM1656

STRING: 99287.STM1656

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ZntB protein in Salmonella typhimurium?

ZntB is a zinc transport protein encoded by the zntB locus in Salmonella enterica serovar Typhimurium. It functions primarily as a zinc efflux pathway, mediating the export of excess zinc from bacterial cells. The protein is homologous to the CorA family of magnesium (Mg2+) transport proteins and is widely distributed among eubacteria. Direct analysis of transport activity has confirmed ZntB's capacity for Zn2+ efflux, establishing it as an important component in bacterial zinc homeostasis systems .

How is ZntB related to other metal transporters in bacteria?

ZntB belongs to the CorA family of cation transporters, which were primarily known for magnesium transport before the discovery of ZntB's role in zinc transport. This discovery expanded our understanding of the functional versatility of the CorA family. While ZntB shares structural similarities with CorA proteins, it specifically mediates the efflux of zinc and possibly cadmium, rather than magnesium. In the context of Salmonella's metal homeostasis mechanisms, ZntB works alongside other transporters such as ZntA and ZitB to maintain appropriate intracellular zinc concentrations .

What is the chromosomal location of the zntB gene in Salmonella typhimurium?

The zntB locus in Salmonella enterica serovar Typhimurium maps to centisome 36 on the bacterial chromosome and is 100% linked to the oxrA (fnr) gene. This chromosomal positioning has been confirmed through bacteriophage P22-mediated cotransduction techniques as well as genome sequencing, providing important information for researchers designing genetic experiments involving zntB .

What are the established protocols for creating zntB mutant strains?

The creation of zntB mutant strains in Salmonella typically involves one-step recombination protocols as described by Datsenko and Wanner. The standard approach includes:

  • Introduction of a plasmid carrying recombination enzymes (such as pKD46) into Salmonella typhimurium via electroporation

  • Amplification of a mutagenic cassette (such as chloramphenicol or kanamycin resistance) with primers containing sequences homologous to the zntB flanking regions

  • Transformation of the purified mutagenic cassette into the strain carrying pKD46

  • Selection of antibiotic-resistant transformants

  • Curing of the recombination plasmid (typically by growth at elevated temperatures like 40°C)

  • Confirmation of chromosomal integration through PCR and sequencing using oligonucleotides external to the integrated cassette

This approach has been successfully used to disrupt the zntB gene in multiple studies, creating valuable tools for investigating zinc transport mechanisms .

How are 65Zn2+ transport assays conducted to measure ZntB activity?

65Zn2+ transport assays are essential for directly measuring ZntB's zinc transport activity. The methodology involves:

  • Culturing wild-type, zntB mutant, and complemented strains under controlled conditions

  • Exposing bacterial cells to radioactive 65Zn2+ for uptake measurements

  • For efflux measurements, preloading cells with 65Zn2+ and then measuring the rate of zinc export

  • Quantifying the total accumulation of 65Zn2+ in different strains

  • Comparing uptake/efflux rates between wild-type strains, zntB mutants, and strains complemented with plasmid-encoded zntB

Results from such assays have demonstrated that wild-type strains and zntB mutants exhibit similar rates of zinc uptake, but the total zinc accumulation in zntB mutants is approximately 1.2-fold greater than in wild-type controls. When complemented with a plasmid expressing functional zntB (such as pAJW54), accumulation levels decrease to nearly wild-type levels, confirming ZntB's role in zinc efflux rather than uptake .

What methods are effective for analyzing zntB gene expression under different conditions?

Analysis of zntB gene expression typically employs quantitative molecular techniques including:

  • RNA extraction using commercial kits (e.g., RNeasy mini kit) following manufacturer's protocols

  • Spectrophotometric determination of RNA concentration and purity

  • RT-PCR or quantitative real-time PCR (qRT-PCR) with appropriate reference genes

  • Normalization of gene expression data to reference genes (such as At5g25760 and At2g28390 in plant-related studies)

  • Statistical analysis to determine significant differences in expression levels

For studies involving bacterial colonization of plants, additional steps include extraction of total RNA from bacteria-inoculated plant tissues. Expression analysis can reveal how zntB responds to varying environmental zinc concentrations or during host colonization .

How does disruption of zntB affect bacterial sensitivity to zinc and other metals?

Disruption of the zntB gene in Salmonella typhimurium significantly alters the bacterium's metal sensitivity profile. Metal sensitivity is typically assessed through disk diffusion assays and growth measurements in media containing varying metal concentrations. Studies have revealed that:

  • zntB mutants show markedly increased zones of sensitivity to zinc and cadmium compared to wild-type strains

  • The mutants display half-maximal growth at approximately 20 μM Zn2+, while wild-type strains can achieve half-maximal growth at 60 μM Zn2+

  • Complementation with plasmid-encoded wild-type zntB partially restores zinc resistance (to approximately 45 μM Zn2+ for half-maximal growth)

  • zntB mutations do not significantly alter sensitivity to other divalent cations such as cobalt, nickel, or manganese

These findings indicate that ZntB specifically mediates resistance to zinc and, to some extent, cadmium toxicity by facilitating the efflux of these metals from the bacterial cell .

What is the relationship between ZntB and other zinc transport systems in Salmonella?

Salmonella maintains zinc homeostasis through multiple transport systems that work in coordination. ZntB functions as part of a network that includes:

  • ZnuABC system - Primary high-affinity zinc uptake system active under zinc-limiting conditions

  • ZupT - Secondary zinc uptake system

  • ZntA - ATP-dependent zinc efflux pump important for zinc detoxification

  • ZitB - Another zinc efflux system that works alongside ZntA and ZntB

These systems create a balanced network of influx and efflux mechanisms that maintain intracellular zinc concentrations within a narrow optimal range. ZntB's role appears to be particularly important under conditions of zinc excess, where it contributes to zinc detoxification by exporting excess zinc from the cytoplasm .

What cellular phenotypes are associated with altered ZntB function?

Alterations in ZntB function lead to several observable phenotypes that provide insights into its biological role:

Strain TypeZinc SensitivityCadmium Sensitivity65Zn2+ AccumulationGrowth in High ZincPlant Colonization Ability
Wild-typeModerateModerateBaselineHalf-maximal at 60 μMEfficient
zntB mutantIncreasedIncreased1.2× wild-typeHalf-maximal at 20 μMReduced*
Complemented mutantPartially restoredUnchanged from mutant1.1× wild-typeHalf-maximal at 45 μMPartially restored*

*Based on extrapolation from studies on related zinc efflux systems (ZntA, ZitB)

These phenotypes collectively indicate that ZntB functions primarily in zinc detoxification and contributes to bacterial survival under conditions of elevated zinc concentrations .

How does the structure of ZntB compare to other CorA family transporters, and what are the implications for zinc transport mechanism?

While the search results don't provide detailed structural information about ZntB, its classification within the CorA family suggests certain structural features. CorA transporters typically form homopentameric complexes with a central ion conduction pathway. The structural adaptations that allow ZntB to transport zinc instead of magnesium (the typical substrate for CorA family members) represent an important area for advanced research.

Key questions for structural studies include:

  • What specific amino acid residues in ZntB coordinate zinc ions during transport?

  • How do the transmembrane domains of ZntB differ from those of magnesium-transporting CorA proteins?

  • What conformational changes occur during the zinc transport cycle?

Addressing these questions would require advanced techniques such as X-ray crystallography, cryo-electron microscopy, and molecular dynamics simulations to elucidate the structural basis of ZntB's zinc transport specificity .

What is the role of ZntB in bacterial pathogenesis and host-pathogen interactions?

The research findings suggest that zinc efflux systems, including ZntB, contribute to Salmonella's ability to colonize host tissues. In plant colonization studies, related zinc efflux systems (ZntA and ZitB) have been shown to be important for Salmonella's ability to colonize plant tissues, suggesting that zinc detoxification is critical during host interaction .

Advanced research questions in this area include:

  • How does host-induced zinc toxicity (nutritional immunity) affect zntB expression?

  • Does ZntB contribute to Salmonella survival within macrophages or other immune cells?

  • What is the relative contribution of ZntB compared to other zinc efflux systems during different stages of infection?

Answering these questions would require infection models, tissue-specific gene expression analysis, and competitive fitness assays comparing wild-type and zntB mutant strains in various host environments .

How is zntB expression regulated in response to varying environmental zinc concentrations?

The regulation of zntB expression likely involves zinc-responsive transcription factors and regulatory networks that sense and respond to changes in environmental and intracellular zinc concentrations. While the search results don't provide specific details about zntB regulation, studies on related zinc transporters indicate that:

  • Expression of zinc transporter genes is often coordinated in time and place

  • Some zinc transporters show rapid induction (within 6-12 hours) upon zinc deficiency

  • Different transporters may be activated at different thresholds of zinc availability

Future research should investigate whether zntB expression is controlled by known zinc-responsive transcription factors (such as Zur or ZntR), the kinetics of its expression in response to changing zinc levels, and potential cross-regulation with other metal transport systems .

What cloning strategies are most effective for recombinant expression of ZntB?

Based on the research methodologies described in the search results, effective cloning strategies for recombinant ZntB expression include:

  • Amplification of the zntB gene from Salmonella typhimurium genomic DNA using high-fidelity polymerase

  • Cloning into low-copy-number vectors (such as the plasmid pAJW54 mentioned in the studies)

  • Verification of construct integrity through sequencing

  • Transformation into appropriate host strains (either Salmonella or E. coli)

  • Functional validation through complementation of zntB mutant phenotypes

The choice of expression system should consider factors such as codon usage, expression level requirements, and the intended experimental applications. For functional studies, achieving near-native expression levels is often more important than maximizing protein yield .

How can researchers effectively measure zinc flux in bacterial systems expressing recombinant ZntB?

Several approaches can be used to measure zinc flux in bacterial systems expressing recombinant ZntB:

  • Radioactive 65Zn2+ transport assays, as described in the search results

  • Fluorescent zinc-specific probes that measure intracellular zinc concentrations

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) for precise quantification of total cellular zinc content

  • Zinc-responsive transcriptional reporters to indirectly measure zinc flux

For direct measurement of ZntB-mediated transport, the 65Zn2+ efflux assay has proven particularly valuable. In this approach, cells are preloaded with 65Zn2+ and then monitored for the rate of zinc export. Studies have shown that expression of functional ZntB can increase zinc efflux rates 5 to 8.8-fold compared to transport-deficient strains .

What considerations are important when designing experiments to study ZntB function in different bacterial species?

When extending ZntB research to different bacterial species, researchers should consider:

  • Genetic tractability of the target species and availability of suitable genetic tools

  • Natural zinc tolerance levels and existing zinc homeostasis mechanisms

  • Appropriate control strains, including:

    • Wild-type strains of the target species

    • Strains with mutations in zntB

    • Complemented strains expressing recombinant zntB

  • Species-specific growth conditions and optimal zinc concentrations

  • Potential interactions with other metal transport systems

  • Appropriate assays to measure zinc sensitivity and transport activity

Cross-species studies of ZntB would be particularly valuable given its wide distribution among eubacteria, potentially revealing how this transport system has adapted to different ecological niches and physiological requirements .

What are the most promising research directions for understanding ZntB function in bacterial physiology?

Future research on ZntB should focus on:

  • Detailed structural studies to elucidate the zinc transport mechanism

  • Systems biology approaches to understand how ZntB integrates with other zinc homeostasis mechanisms

  • Investigation of ZntB's role in bacterial pathogenesis and host-pathogen interactions

  • Comparative studies across diverse bacterial species to understand evolutionary adaptation of zinc transport systems

  • Potential applications in synthetic biology for creating bacteria with altered metal tolerance or accumulation properties

These research directions would contribute to our fundamental understanding of bacterial metal homeostasis while potentially opening avenues for applications in biotechnology and medicine .

How might understanding ZntB function contribute to broader research in bacterial metal homeostasis?

The study of ZntB provides insights into several important aspects of bacterial metal homeostasis:

  • The functional diversity of the CorA transporter family and its evolutionary adaptations

  • Coordination mechanisms between uptake and efflux systems in maintaining optimal intracellular zinc concentrations

  • Bacterial adaptations to varying environmental metal conditions

  • Potential targets for developing new antimicrobial strategies that disrupt metal homeostasis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.