Recombinant Salmonella typhimurium Zinc transporter zitB (zitB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. This serves as a reference for your own preparations.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
zitB; STM0758; Zinc transporter ZitB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
zitB
Target Protein Sequence
MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGSLALLADAGHMLTDAAA LLFALLAVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVITLLIVWEAIERFYTPRPVA GNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHVMGDLLGSVGAIVAALIIIWT GWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINALQRHLSREIPEVRNVH HVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFLMHEYHIAHATIQMEYQVCHGPDCH LNQTSSGHVHHH
Uniprot No.

Target Background

Function
This protein is involved in zinc efflux across the cytoplasmic membrane, thereby reducing zinc accumulation within the cytoplasm and enhancing bacterial resistance to zinc. It may contribute to zinc homeostasis at low zinc concentrations.
Database Links

KEGG: stm:STM0758

STRING: 99287.STM0758

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of ZitB in Salmonella typhimurium?

ZitB functions as a zinc efflux transporter that helps maintain zinc homeostasis in Salmonella. While zinc is an essential cofactor for numerous proteins, elevated concentrations are highly toxic to bacterial cells. ZitB works alongside other efflux systems, particularly ZntA, to mitigate the cytotoxic effects of free zinc by exporting excess zinc ions out of the bacterial cell . This function becomes particularly important during host infection, where zinc levels may fluctuate dramatically, especially in response to host immune defenses such as nitric oxide production .

How does ZitB compare to other zinc transporters in Salmonella?

Salmonella typhimurium possesses multiple zinc transport systems that collectively maintain proper zinc homeostasis. For efflux, S. Typhimurium has three predicted zinc exporters (ZntA, ZntB, and ZitB) as well as a putative fourth system (YiiP) . ZntA appears to be the primary zinc efflux system, as demonstrated by growth defects of ΔzntA mutants at lower zinc concentrations compared to ΔzitB mutants . For zinc uptake, Salmonella uses the ZnuABC and ZupT transport systems . The ZnuABC system serves as the primary zinc influx pathway and is induced under zinc-limited conditions . This complex network of transporters allows Salmonella to maintain zinc levels within a narrow range that supports essential functions while preventing toxicity.

What genetic tools are effective for studying zitB function?

Researchers typically employ targeted gene deletion strategies to study zitB function. Both single gene deletions (ΔzitB) and combinatorial deletions (ΔzntA ΔzitB) have been constructed to assess the relative importance of different zinc efflux systems . The use of antibiotic resistance cassettes for disrupting the zitB coding sequence has been documented, with subsequent confirmation through bacteriophage P22-mediated cotransduction techniques to verify the position of the mutation . For complementation studies, researchers can clone the intact zitB gene into expression plasmids under inducible promoters to confirm that observed phenotypes are specifically due to zitB disruption rather than polar effects or secondary mutations.

How can researchers measure zinc efflux activity mediated by ZitB?

Fluorescent zinc sensors provide a powerful approach for quantifying intracellular free zinc levels and, by extension, ZitB activity. The ZapCV5 zinc sensor, which contains zinc fingers coupled to fluorescent proteins that enable FRET (Fluorescence Resonance Energy Transfer), has been successfully used to measure zinc accumulation in Salmonella . This sensor contains modified cysteine ligands in the zinc finger region, making it insensitive to S-nitrosylation by NO·, which is crucial when studying zinc homeostasis during nitrosative stress . In addition to fluorescent sensors, direct measurement of ⁶⁵Zn efflux from preloaded cells can provide quantitative data on ZitB transport activity. Growth assays in media supplemented with defined zinc concentrations offer a simpler approach to assess the functional consequences of ZitB activity .

What cellular models are appropriate for investigating ZitB during infection?

Two primary infection models have been utilized to study ZitB function in host-pathogen interactions. The macrophage infection model using J774.1 murine macrophages allows for assessment of bacterial survival within professional phagocytes . This model is particularly valuable for studying zinc homeostasis during nitrosative stress, as activated macrophages produce nitric oxide through inducible nitric oxide synthase (iNOS) . Interestingly, higher bacterial counts were observed for ΔzntA and ΔzntA ΔzitB mutants compared to wild-type at 4 hours post-infection in Nramp1-negative J774.1 macrophages, although the fold net replication was similar between strains . Amoeba infection models have also been employed, though no significant differences in uptake or survival were detected for zinc exporter mutants compared to wild-type during amoebae infection .

What is the relationship between nitric oxide exposure and ZitB function?

Nitric oxide (NO·) dramatically affects zinc homeostasis in Salmonella, creating a direct link to ZitB function. NO· disrupts zinc metalloproteins, including those involved in DNA replication and repair (DnaG, PriA, and TopA), protein synthesis (AlaS and RpmE), and various metabolic activities (ClpX, GloB, MetE, PepA, and QueC) . This disruption releases free zinc within the bacterial cell, necessitating increased efflux activity. Both ZntA and ZitB are required to efflux zinc mobilized by NO·, and either transporter alone is sufficient to prevent NO· hypersusceptibility . The mobilization of zinc by NO· and its subsequent efflux by ZntA and ZitB has been demonstrated both in vitro and in bacteria following internalization by NO·-producing macrophages . This relationship explains why zinc efflux becomes particularly important during infection of hosts capable of mounting a nitrosative stress response.

What experimental data quantifies intracellular zinc levels in relation to ZitB activity?

Using the ZapCV5 zinc sensor, researchers have directly measured the accumulation of free intracellular zinc in Salmonella strains with different zinc efflux capabilities. In wild-type cells, exposure to increasing external zinc concentrations results in minimal changes to intracellular free zinc levels, indicating effective homeostatic control . In contrast, ΔzntA ΔzitB double mutants show significantly increased FRET ratios following exposure to elevated ZnSO₄ concentrations, demonstrating their inability to maintain zinc homeostasis . This experimental approach provides quantitative evidence that the absence of these efflux systems results in increased levels of free intracellular zinc. Similar measurements in bacteria recovered from macrophages have confirmed that NO·-dependent zinc mobilization occurs during infection and that ZntA and ZitB are required to mitigate this effect .

How does ZitB contribute to Salmonella virulence during infection?

ZitB's contribution to Salmonella virulence is most evident in the context of host-derived nitrosative stress. In a murine infection model using NO·-producing C3H/HeOuJ mice, ΔzntA ΔzitB double mutants were significantly outcompeted by isogenic wild-type Salmonella in both the liver and spleen when administered in a 1:1 ratio . This competitive disadvantage disappeared when mice were treated with the iNOS inhibitor L-NIL, demonstrating that zinc efflux becomes crucial for virulence specifically in the presence of host-derived NO· . These findings establish a direct link between nitrosative stress, zinc homeostasis, and bacterial virulence, positioning ZitB (in conjunction with ZntA) as an important factor in Salmonella's arsenal for surviving host immune responses.

How does zinc concentration affect Salmonella survival in different host environments?

Host environments present varying zinc challenges for Salmonella, requiring differential zinc homeostasis responses. Within activated macrophages, NO· production mobilizes zinc from bacterial metalloproteins, creating an internal zinc stress condition that requires efflux through ZntA and ZitB . Conversely, some host environments may restrict zinc availability as an antimicrobial strategy, necessitating zinc acquisition systems. Interestingly, higher bacterial counts were observed for ΔzntA and ΔzntA ΔzitB mutants compared to wild-type at early timepoints post-infection (4 hours) in J774.1 macrophages, suggesting complex dynamics in zinc availability and utilization during different infection phases . Zinc concentrations may also vary between different tissues, potentially explaining tissue-specific requirements for zinc transporters during systemic infection.

What is the experimental evidence linking ZitB to resistance against host immune defenses?

The clearest evidence linking ZitB to resistance against host immunity comes from competitive infection experiments in NO·-producing mice. ΔzntA ΔzitB double mutants exhibit a significant competitive disadvantage compared to wild-type Salmonella in both liver and spleen of infected C3H/HeOuJ mice . This disadvantage is eliminated when mice are treated with L-NIL to inhibit iNOS activity, demonstrating that zinc efflux specifically confers resistance to NO·-mediated immunity . At the cellular level, ΔzntA ΔzitB mutants accumulate higher levels of free zinc following exposure to NO·-producing macrophages, as measured using the ZapCV5 zinc sensor . The selective pressure to maintain zinc efflux systems during infection of NO·-producing hosts provides strong evidence that these transporters represent an adaptation specifically evolved to counter host immune defenses.

What methodological challenges exist in distinguishing ZitB activity from other zinc transporters?

A significant challenge in studying ZitB is isolating its specific contribution from the network of zinc transporters in Salmonella. The functional redundancy between ZntA and ZitB necessitates the creation of multiple mutant strains to fully characterize ZitB's role . Additionally, zinc sensors like ZapCV5 measure total intracellular free zinc but cannot directly attribute changes to specific transporters without appropriate genetic controls . Researchers must carefully design experiments using combinations of single and double mutants to deconvolute the relative contributions of each transporter. Another challenge is that measuring transporter activity in vivo during infection requires specialized tools like zinc-responsive fluorescent reporters that function under the complex conditions found within host cells. Future studies might benefit from development of ZitB-specific inhibitors or tagged versions of the protein that allow direct monitoring of its expression and localization.

How might post-translational regulation affect ZitB function during infection?

While transcriptional regulation of zinc transporters is well established, post-translational regulation remains less understood. Evidence suggests that NO· can cause S-nitrosylation of various proteins and disrupt metal centers, which could potentially influence ZitB function directly or indirectly . The ZapCV5 zinc sensor required modification of cysteine ligands to histidine to render it insensitive to S-nitrosylation, indicating that zinc-binding proteins are susceptible to this modification . Future research could investigate whether ZitB undergoes similar modifications during nitrosative stress and how these might affect its function. Additional post-translational mechanisms like phosphorylation, acetylation, or proteolytic processing might also regulate ZitB activity under different environmental conditions, providing another layer of control over zinc homeostasis during infection.

What structural features of ZitB determine its substrate specificity and transport efficiency?

Detailed structural analysis of ZitB could provide insights into its function and potential for targeting. While ZntA appears to handle higher zinc concentrations more effectively than ZitB, the molecular basis for this difference remains unclear . Comparative structural analysis between ZitB and other transporters like ZntA could reveal features that determine substrate affinity, transport kinetics, and ion selectivity. Of particular interest would be understanding why ZntA can compensate for the absence of ZitB, while ZitB can only partially compensate for the absence of ZntA . Additionally, exploring whether ZitB can transport other divalent cations besides zinc, as suggested by increased sensitivity of ΔzntA ΔzitB mutants to copper , could provide insights into its broader role in metal homeostasis. Structural studies combined with site-directed mutagenesis could identify critical residues for substrate binding and transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.