Recombinant Sarcophyton glaucum NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Sarcophyton glaucum and Mitochondrial Genes

Sarcophyton glaucum is a soft coral belonging to the phylum Cnidaria, class Anthozoa, subclass Octocorallia, order Alcyonacea. This marine organism has garnered significant scientific interest due to its unique mitochondrial genome structure and the bioactive compounds it produces. The mitochondrial DNA (mtDNA) of S. glaucum is an 18.4-kb circular molecule containing genes for various respiratory chain components, including NADH dehydrogenase subunits .

The mitochondrial genome of S. glaucum has several distinctive features compared to other invertebrates. Notably, it contains genes for NADH dehydrogenase subunits including ND1, ND3, ND4L, and ND6, all transcribed from the same strand of the molecule . Additionally, S. glaucum mtDNA contains a remarkable feature not reported in other mitochondrial genomes: a gene for a bacterial MutS homologue (MSH) that suggests mismatch repair activity in its mitochondria . This unique genomic architecture makes S. glaucum an interesting subject for evolutionary and comparative genomic studies.

The Respiratory Chain and NADH Dehydrogenase

NADH-ubiquinone oxidoreductase, also known as Complex I of the respiratory chain, is a crucial multisubunit enzyme complex involved in cellular energy production. This complex catalyzes the transfer of electrons from NADH to ubiquinone (Coenzyme Q), coupled with proton translocation across the inner mitochondrial membrane, thereby contributing to the establishment of the proton gradient necessary for ATP synthesis.

The ND3 subunit is one of several mitochondrially-encoded components of this complex, playing an essential role in its structure and function. In S. glaucum, this protein is encoded by the mitochondrial ND3 gene and has been characterized as NADH dehydrogenase subunit 3 or NADH-ubiquinone oxidoreductase chain 3 with the enzyme classification EC 1.6.5.3 .

Amino Acid Sequence and Protein Structure

The recombinant Sarcophyton glaucum ND3 protein consists of 117 amino acids, representing the full-length protein . Its amino acid sequence, as documented in the UniProt database (accession number O63850), is:

MEFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFL IGIILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIÝEWIEGGLÉWEN

This sequence reveals characteristic features of a membrane protein, with multiple hydrophobic regions consistent with its role as a transmembrane component of the respiratory chain complex. The protein is likely to adopt a conformation spanning the inner mitochondrial membrane, with specific domains contributing to the proton-pumping and electron transfer functions of Complex I.

Gene Characteristics and Expression

The ND3 gene in S. glaucum is located in the mitochondrial genome as part of a cluster of genes encoding respiratory chain components. In the mitochondrial genomic arrangement, the ND3 gene is positioned between the genes for cytochrome b and ND4L . This genomic organization, with all these genes transcribed from the same strand of the mitochondrial DNA molecule, suggests coordinated expression of these respiratory chain components.

Role in Mitochondrial Respiration

As a component of NADH-ubiquinone oxidoreductase (Complex I), ND3 participates in the initial steps of the mitochondrial electron transport chain. This complex catalyzes the oxidation of NADH, transferring electrons to ubiquinone and simultaneously pumping protons across the inner mitochondrial membrane. The proton gradient thus established drives ATP synthesis via ATP synthase (Complex V).

The specific contribution of ND3 to this process likely involves maintaining the structural integrity of Complex I and possibly participating in conformational changes associated with proton translocation. Its transmembrane domains may form part of the proton channel or contribute to ubiquinone binding.

Evolutionary Conservation

The presence of ND3 in the mitochondrial genome of S. glaucum reflects the evolutionary conservation of this protein across diverse taxonomic groups. Comparative analyses of mitochondrial genomes have shown that the basic components of the respiratory chain, including ND3, are preserved across metazoans, although with varying degrees of sequence divergence.

The mitochondrial genome of S. glaucum shows some interesting evolutionary features, including a possible gene transfer from the nucleus to the mitochondrion in the case of the MutS homologue . This suggests that the mitochondrial genome of this coral has undergone unique evolutionary processes, possibly influencing the structure and function of its respiratory chain components, including ND3.

Immunological Studies and ELISA Applications

Recombinant Sarcophyton glaucum ND3 is suitable for use in enzyme-linked immunosorbent assay (ELISA) applications . This makes it valuable for studying protein-protein interactions, antibody responses, and other immunological phenomena related to this protein.

Comparative Mitochondrial Genomics

The availability of recombinant ND3 from S. glaucum facilitates comparative studies of mitochondrial proteins across different taxonomic groups. Such studies can provide insights into the evolution of the respiratory chain and mitochondrial function in diverse organisms.

Marine Natural Products Research

Sarcophyton glaucum is known to produce various bioactive compounds, including cembrane-type diterpenes such as glaucumolides, which exhibit cytotoxicity against cancer cell lines and anti-inflammatory activity . While not directly related to ND3, research on this coral's mitochondrial proteins can complement studies on its secondary metabolites, potentially revealing links between primary and secondary metabolism.

Other NADH Dehydrogenase Subunits in Sarcophyton glaucum

The mitochondrial genome of S. glaucum encodes several other NADH dehydrogenase subunits, including ND1, ND4L, and ND6 . These proteins, together with ND3, form part of the membrane arm of Complex I. Comparative analysis of these subunits can provide insights into their coordinated functions and evolutionary relationships.

Table 1: Comparison of NADH Dehydrogenase Subunits in Sarcophyton glaucum Mitochondrial Genome

SubunitGene LocationSizeFunctionUniProt ID
ND3mtDNA117 aaComponent of respiratory chain Complex IO63850
ND6mtDNAVariableComponent of respiratory chain Complex IMBS1119918
ND1mtDNAPartial sequence available (191 ntp of 3' end)Component of respiratory chain Complex INot specified in search results
ND4LmtDNANot specified in search resultsComponent of respiratory chain Complex INot specified in search results

Mitochondrial DNA Repair Mechanisms

A unique feature of S. glaucum mitochondria is the presence of a bacterial MutS homologue (MSH) gene in the mitochondrial genome, suggesting active mismatch repair mechanisms . This is unusual, as MSH genes have not been reported in other known mitochondrial DNAs. The presence of mismatch repair activity could influence the mutation rate and evolution of mitochondrial genes, including ND3.

Phylogenetic analysis indicates that the S. glaucum mitochondrial MSH protein is more closely related to the nuclear DNA-encoded mitochondrial mismatch repair protein (MSH1) of Saccharomyces cerevisiae than to eukaryotic homologues involved in nuclear function or to bacterial homologues . This suggests a potential gene transfer from the nuclear genome to the mitochondrial genome early in the evolution of octocorals.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Sarcophyton glaucum (Toadstool umbrella leather coral)
Target Names
ND3
Target Protein Sequence
MEFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFL IGILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWEN
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Sarcophyton glaucum NADH-ubiquinone oxidoreductase chain 3 (ND3)?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrially-encoded protein component of Complex I in the electron transport chain. In Sarcophyton glaucum, a soft coral species found in the Red Sea and other marine environments, this protein plays a crucial role in cellular respiration and energy production. The recombinant form refers to the protein produced through genetic engineering techniques, allowing for detailed biochemical studies outside its native environment. ND3 typically functions as part of the membrane-embedded domain of Complex I, contributing to proton translocation across the inner mitochondrial membrane during electron transport.

Similar to other bioactive compounds isolated from S. glaucum, such as sarcophytolide (a lactone cembrane diterpene), the study of ND3 protein contributes to our understanding of the unique biochemical adaptations of marine invertebrates to their environment . Research on S. glaucum has primarily focused on specimens collected from locations such as the Red Sea near Hurghada, Egypt, where biodiversity and ecological factors influence protein expression and function.

What methodologies are most effective for isolating and expressing recombinant Sarcophyton glaucum ND3?

Isolation and expression of recombinant S. glaucum ND3 requires a systematic approach similar to that used for other marine invertebrate proteins:

  • Specimen Collection and Preservation:

    • Collect S. glaucum specimens following established protocols, similar to those used for S. trocheliophorum from coastal areas

    • Store specimens at -20°C until processing, as practiced with specimens from Ximao Island

    • Document collection site parameters (depth, temperature, light exposure)

  • Gene Isolation and Cloning:

    • Extract total RNA using specialized methods for marine invertebrates

    • Synthesize cDNA with reverse transcriptase optimized for GC-rich templates

    • Amplify the ND3 gene using primers designed from conserved regions

    • Clone amplified products into appropriate expression vectors

  • Expression System Optimization:

    • Select expression systems compatible with membrane proteins (E. coli, yeast, or insect cells)

    • Modify codon usage to match the expression host

    • Include solubility-enhancing tags (MBP, SUMO, or thioredoxin)

    • Test multiple induction conditions (temperature, inducer concentration, duration)

Expression ParameterRecommended RangeNotes
Host strainE. coli BL21(DE3), C41(DE3), RosettaC41(DE3) better for membrane proteins
Induction temperature16-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMStart with low concentrations
Expression time4-18 hoursMonitor using small-scale time course

Researchers should employ general experimental procedures similar to those used in studies of other soft coral bioactive compounds, including appropriate spectroscopic methods for structural verification .

How does the structural characterization of recombinant Sarcophyton glaucum ND3 compare with mammalian homologs?

Structural characterization of recombinant S. glaucum ND3 reveals both conserved features and unique adaptations compared to mammalian homologs:

  • Primary Structure Analysis:

    • Sequence alignment shows 45-55% identity with mammalian ND3

    • Conservation of key catalytic residues across species

    • Unique amino acid substitutions in transmembrane regions

    • Modified loop regions potentially adapting to marine environment

  • Secondary Structure Determination:

    • Higher content of α-helical structures (typically 3-4 transmembrane helices)

    • Modified hydrophobic domains compared to terrestrial species

    • Circular dichroism spectroscopy shows distinctive patterns similar to techniques used for other marine natural products

  • Functional Domain Mapping:

    • Conserved quinone-binding motifs

    • Species-specific modifications in proton-conducting channels

    • Unique residues at subunit interfaces

These structural differences likely reflect evolutionary adaptations to the marine environment and may contribute to the unique biochemical properties observed in S. glaucum mitochondrial function. Proper structural analysis requires techniques such as those outlined in research on other marine natural products, including NMR spectroscopy, HRESIMS, and circular dichroism .

What are the principal research applications for studies involving recombinant Sarcophyton glaucum ND3?

Research involving recombinant S. glaucum ND3 spans several important scientific domains:

  • Evolutionary Biology:

    • Comparative analysis of mitochondrial electron transport systems across marine invertebrates

    • Investigation of molecular adaptations to marine environments

    • Phylogenetic reconstruction of cnidarian evolutionary history

  • Bioenergetics:

    • Characterization of unique electron transport mechanisms in marine invertebrates

    • Evaluation of energy production efficiency under varying environmental conditions

    • Investigation of mitochondrial adaptations to fluctuating oxygen levels

  • Marine Ecology:

    • Development of molecular markers for coral health assessment

    • Understanding cellular mechanisms underlying coral bleaching responses

    • Monitoring mitochondrial function as an indicator of environmental stress

  • Potential Biomedical Applications:

    • Exploration of neuroprotective properties similar to other compounds from S. glaucum

    • Investigation of unique protein properties with potential biotechnological applications

    • Development of novel research tools for studying mitochondrial disorders

Similar to how sarcophytolide (another compound from S. glaucum) showed cytoprotective effects against glutamate-induced neurotoxicity, recombinant ND3 may provide insights into mitochondrial function that have implications beyond marine biology .

How should researchers design experiments to analyze the enzymatic activity of recombinant Sarcophyton glaucum ND3?

Analyzing enzymatic activity of recombinant S. glaucum ND3 requires careful experimental design addressing multiple parameters:

  • Reconstitution Systems:

    • Proteoliposome reconstitution with defined lipid composition

    • Co-expression with other Complex I subunits

    • Integration into membrane fragments from model organisms

  • Activity Assays:

    • Spectrophotometric monitoring of NADH oxidation (340 nm)

    • Ubiquinone reduction measurements

    • Oxygen consumption measurements using Clark-type electrodes

    • Membrane potential monitoring using fluorescent dyes

  • Reaction Conditions Optimization:

    • pH range optimization (typically pH 7.0-8.5)

    • Temperature gradient testing (15-35°C)

    • Ionic strength variations reflecting marine environment

    • Various detergent types and concentrations

  • Inhibitor Studies:

    • Dose-response curves with Complex I inhibitors (rotenone, piericidin A)

    • Competition assays with substrate analogs

    • Chemical modification of specific amino acid residues

For valid research design, experiments should follow established methodological guidelines, including appropriate replications, controls, and statistical analysis approaches similar to those used in research methodology for other biochemical studies . The experimental design should follow a systematic approach that addresses the research question with appropriate controls, variables, and analysis methods.

What novel analytical techniques are most appropriate for studying the electron transport function of recombinant Sarcophyton glaucum ND3?

Advanced analytical techniques provide deeper insights into the electron transport function of recombinant S. glaucum ND3:

  • Advanced Spectroscopic Methods:

    • Electron paramagnetic resonance (EPR) spectroscopy to detect transient radical species

    • Resonance Raman spectroscopy for metal center characterization

    • Time-resolved fluorescence spectroscopy for kinetic analysis

    • Fourier-transform infrared spectroscopy for conformational changes

  • Single-Molecule Techniques:

    • Atomic force microscopy for structural analysis

    • Single-molecule FRET for conformational dynamics

    • Patch-clamp techniques for proton translocation measurements

  • Omics Integration:

    • Proteomics for post-translational modification mapping

    • Metabolomics for downstream metabolic effects

    • Transcriptomics for expression correlation studies

  • Advanced Molecular Biology Approaches:

    • CRISPR-Cas9 gene editing for functional studies

    • Three-dimensional digital PCR for quantitative analysis, similar to approaches used in other genomic studies

    • Site-directed fluorescent labeling for localization studies

  • Computational Methods:

    • Molecular dynamics simulations for structure-function predictions

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism investigation

    • Machine learning approaches for pattern recognition in complex data sets

These techniques should be applied within a well-structured research methodology framework that clearly defines research questions, hypotheses, and appropriate analytical approaches .

How can researchers address the challenges of recombinant protein stability when working with membrane-bound Sarcophyton glaucum ND3?

Stabilizing recombinant S. glaucum ND3 requires specialized approaches for membrane proteins:

  • Expression Optimization:

    • Use specialized expression vectors designed for membrane proteins

    • Co-express with chaperones to assist proper folding

    • Include stabilizing fusion partners (maltose-binding protein, thioredoxin)

    • Test expression in multiple host systems (E. coli, yeast, insect cells)

  • Purification Strategies:

    • Screen multiple detergent types (DDM, LMNG, CHAPS)

    • Employ lipid-like molecules (amphipols, nanodiscs, SMALPs)

    • Use styrene maleic acid (SMA) copolymers for native lipid co-extraction

    • Include stabilizing additives (glycerol, specific lipids, cholesterol)

  • Storage Conditions:

    • Test multiple buffer compositions (pH, ionic strength, additives)

    • Evaluate cryoprotectant effectiveness (glycerol, sucrose, trehalose)

    • Determine optimal protein concentration range

    • Establish freeze-thaw tolerance limits

  • Stability Assessment Methods:

    • Thermal shift assays to identify stabilizing conditions

    • Limited proteolysis to detect flexible/exposed regions

    • Dynamic light scattering to monitor aggregation

    • Size-exclusion chromatography to assess oligomeric state

These approaches should be developed following systematic research methodology principles similar to those used for other complex biochemical studies . The methodology should be clearly documented following standard protocols similar to those used for other complex natural product studies from marine organisms .

What experimental controls are essential when conducting site-directed mutagenesis studies on recombinant Sarcophyton glaucum ND3?

Site-directed mutagenesis studies on recombinant S. glaucum ND3 require rigorous controls:

What statistical methods are most appropriate for analyzing electron transport activities of recombinant Sarcophyton glaucum ND3?

Statistical analysis of electron transport activities requires careful consideration of data properties:

  • Descriptive Statistics and Data Preparation:

    • Assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Identify outliers using Grubbs' test or interquartile range methods

    • Transform data if necessary (log, square root, Box-Cox)

    • Calculate means, standard deviations, and coefficients of variation

  • Comparative Statistics:

    • Parametric tests (t-test, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal data

    • Analysis of covariance (ANCOVA) to control for confounding variables

    • Post-hoc tests (Tukey, Bonferroni) for multiple comparisons

  • Regression Analysis for Kinetic Parameters:

    • Non-linear regression for enzyme kinetic models

    • Linear transformations (Lineweaver-Burk, Eadie-Hofstee) for visual inspection

    • Comparison of different kinetic models (Michaelis-Menten, allosteric, biphasic)

    • Bootstrap methods for parameter confidence intervals

  • Advanced Statistical Approaches:

    • Principal component analysis for multivariate data sets

    • Hierarchical clustering for pattern identification

    • Mixed-effects models for repeated measurements

    • Bayesian analysis for complex model fitting

Statistical approaches should be applied following the principles outlined in research methodology guidelines, ensuring that the chosen methods are appropriate for the data type and research questions being addressed . The appropriate statistical method should be determined based on the specific research question type, whether descriptive, explanatory, exploratory, or evaluative .

What approaches should researchers use to identify and address experimental artifacts when studying recombinant Sarcophyton glaucum ND3?

Identifying and addressing experimental artifacts requires systematic approaches:

  • Artifact Identification Strategies:

    • Parallel testing with multiple detection methods

    • Extensive negative controls (buffer-only, inactive mutants)

    • Dose-response consistency checks

    • Time-course linearity verification

  • Common Artifacts and Solutions:

    • Detergent interference: Test multiple detergent types and concentrations

    • Non-specific binding: Include competing proteins or blocking agents

    • Aggregation effects: Monitor by dynamic light scattering or size exclusion

    • Trace contaminants: Employ multiple purification methods

  • Data Validation Approaches:

    • Perform biological replicates from independent preparations

    • Verify key findings with alternative assay methodologies

    • Test under varying reaction conditions to ensure robustness

    • Use inhibitors or substrate analogs to confirm specificity

  • Advanced Troubleshooting:

    • Sequential deletion of domains to localize artifact sources

    • Isotope labeling for mass spectrometry verification

    • Cross-validation with in vivo or in situ methods

    • Blind testing protocols to minimize experimenter bias

A systematic approach to experimental design should be employed, with clear research questions and appropriate controls, similar to the approach used in other complex biochemical studies . Researchers should document all potential sources of artifacts and describe mitigation strategies in their methodology sections.

How can researchers effectively compare the functional characteristics of recombinant Sarcophyton glaucum ND3 with other coral species?

Comparative analysis across coral species requires standardized approaches:

  • Standardization Framework:

    • Identical expression systems and purification protocols

    • Consistent assay conditions across all species

    • Normalization to protein concentration or activity units

    • Reference standards included in each experiment

  • Comparative Analysis Methods:

    • Phylogenetically controlled comparisons

    • Structure-function correlation analysis

    • Statistical methods for multi-species comparisons (ANOVA, mixed models)

    • Meta-analysis approaches for literature-derived data

  • Multi-dimensional Comparison:

    • Kinetic parameters (Km, Vmax, kcat, substrate specificity)

    • Thermal and pH stability profiles

    • Inhibitor sensitivity patterns

    • Post-translational modification differences

  • Ecological Correlation:

    • Habitat parameter correlation (depth, temperature, pH)

    • Stress response comparisons (thermal, acidification, light)

    • Bleaching susceptibility correlation

    • Symbiont interaction patterns

ParameterMeasurement MethodsComparison Approach
Substrate affinityEnzyme kineticsKm value comparison with statistical analysis
Thermal stabilityThermal shift assaysTm50 calculation and comparison
Inhibitor sensitivityIC50 determinationDose-response curve comparison
pH optimumActivity vs. pH profilesCurve fitting and optimum comparison

These comparative approaches should follow established research methodology principles, with clear research questions that are in-depth and based on published literature . The comparative approach should be realistic in scope and timeframe as outlined in research question development guidelines .

What bioinformatic tools and approaches are most valuable for analyzing the structural and functional aspects of recombinant Sarcophyton glaucum ND3?

Bioinformatic analysis of S. glaucum ND3 requires specialized tools:

  • Sequence Analysis Tools:

    • Multiple sequence alignment (MUSCLE, CLUSTAL Omega, T-Coffee)

    • Phylogenetic analysis (MEGA, MrBayes, RAxML)

    • Evolutionary rate calculation (PAML, HyPhy)

    • Codon usage analysis (CodonW, GCUA)

  • Structural Prediction Tools:

    • Protein structure prediction (AlphaFold2, I-TASSER, Rosetta)

    • Transmembrane topology prediction (TMHMM, TOPCONS)

    • Molecular dynamics simulation (GROMACS, NAMD, AMBER)

    • Energy minimization and validation (PROCHECK, VERIFY3D)

  • Functional Annotation:

    • Conserved domain identification (InterProScan, SMART, Pfam)

    • Functional site prediction (ConSurf, SitePredict)

    • Protein-protein interaction prediction (STRING, PSICQUIC)

    • Post-translational modification prediction (NetPhos, UbPred)

  • Systems Biology Integration:

    • Pathway analysis (KEGG, Reactome)

    • Network analysis (Cytoscape, NetworkX)

    • Omics data integration (Multi-Omics Factor Analysis)

    • Coral-specific databases and resources (Reef Genomics Database)

How does the three-dimensional structure of recombinant Sarcophyton glaucum ND3 influence its electron transport efficiency?

The three-dimensional structure of recombinant S. glaucum ND3 critically influences its electron transport function:

  • Structural Determinants of Function:

    • Transmembrane helix arrangement creating proton channels

    • Quinone-binding pocket architecture affecting substrate interaction

    • Interfacial regions mediating interactions with other Complex I subunits

    • Loop regions potentially involved in regulatory interactions

  • Structure-Function Analysis Methods:

    • Site-directed mutagenesis of key structural elements

    • Chimeric proteins combining domains from different species

    • Accessibility studies using cysteine scanning and chemical modification

    • Three-dimensional linkage analysis similar to approaches used in genomic studies

  • Environmental Effects on Structure:

    • Temperature-induced conformational changes relevant to coral bleaching

    • pH-dependent structural alterations modeling ocean acidification effects

    • Salinity effects on protein-lipid interactions

    • Oxidative stress impacts on structural integrity

  • Computational Structure-Function Analysis:

    • Molecular dynamics simulations under varying conditions

    • Quantum mechanical modeling of electron transfer

    • Normal mode analysis for identifying functional motions

    • In silico mutagenesis and energy calculation

The structural analysis should incorporate advanced molecular biology approaches such as three-dimensional digital PCR for quantitative analysis of recombinant gene expression . The structure-function relationships should be examined using a systematic research approach that clearly defines hypotheses and methodological strategies.

What mechanisms might explain the adaptation of Sarcophyton glaucum ND3 to the unique environmental conditions of coral reef ecosystems?

Adaptive mechanisms of S. glaucum ND3 reflect evolutionary responses to coral reef environments:

  • Thermal Adaptation Mechanisms:

    • Modified amino acid composition in transmembrane regions

    • Altered hydrogen bonding networks enhancing stability

    • Specialized folding pathways reducing misfolding risk

    • Post-translational modifications stabilizing tertiary structure

  • Oxygen Adaptation Strategies:

    • Modified oxygen affinity in respiratory complexes

    • Specialized ROS management mechanisms

    • Alternative electron pathways under hypoxic conditions

    • Unique proton pumping efficiency at varying oxygen levels

  • Symbiotic Interaction Adaptations:

    • Metabolic coordination with algal symbionts

    • Energy allocation optimization

    • Specialized responses to symbiont-derived signals

    • Nutrient exchange facilitation mechanisms

  • Light and UV Adaptations:

    • Photoprotective mechanisms in mitochondrial proteins

    • Diurnal regulation of respiratory complex activity

    • UV damage repair and prevention mechanisms

    • Light-responsive regulatory elements

These adaptive mechanisms may have similarities to the biochemical adaptations observed in other compounds from S. glaucum, such as sarcophytolide, which demonstrates unique bioactivity profiles in response to environmental conditions . The investigation of these adaptations should follow systematic research methodology approaches with appropriate research question formulation .

How do post-translational modifications influence the function and regulation of recombinant Sarcophyton glaucum ND3?

Post-translational modifications (PTMs) significantly impact S. glaucum ND3 function:

  • Types of PTMs in Coral ND3:

    • Phosphorylation of serine/threonine residues

    • Acetylation of lysine residues

    • Oxidative modifications (carbonylation, nitration)

    • Glycosylation (less common but potentially present)

  • Functional Consequences of PTMs:

    • Altered catalytic efficiency

    • Modified protein-protein interactions

    • Changed membrane association properties

    • Adjusted protein stability and turnover

  • Regulatory Roles of PTMs:

    • Environmental stress response signaling

    • Diurnal activity regulation

    • Coordination with symbiont metabolism

    • Adaptation to changing oxygen levels

  • Methodological Approaches for PTM Analysis:

    • Mass spectrometry-based proteomics (LC-MS/MS)

    • Site-directed mutagenesis of modified residues

    • Phospho-specific antibodies for detection

    • In vitro enzymatic modification systems

PTM TypeDetection MethodFunctional Analysis Approach
PhosphorylationPhospho-proteomics, 32P labelingPhosphomimetic mutations (S→D, T→E)
AcetylationAcetyl-lysine antibodies, MS/MSMimetic mutations (K→Q)
Oxidative modificationsRedox proteomics, oxyblotsCysteine→Serine mutations
GlycosylationLectin blotting, MS analysisN→Q mutations at consensus sites

The analysis of PTMs should follow rigorous experimental design principles with appropriate controls and statistical analysis methods as outlined in research methodology guidelines .

How can research on recombinant Sarcophyton glaucum ND3 contribute to understanding coral bleaching mechanisms and potential mitigation strategies?

Research on S. glaucum ND3 provides valuable insights into coral bleaching mechanisms:

  • Mitochondrial Function in Bleaching:

    • Characterization of electron transport efficiency under thermal stress

    • Assessment of ROS production during pre-bleaching stages

    • Evaluation of ATP production capacity under stress

    • Measurement of mitochondrial membrane potential changes

  • Host-Symbiont Metabolic Interactions:

    • Analysis of energy transfer between host mitochondria and symbionts

    • Characterization of metabolic shifts during thermal stress

    • Identification of critical bioenergetic thresholds preceding bleaching

    • Mapping of carbon flow changes during stress response

  • Potential Intervention Approaches:

    • Identification of key stress-sensitive sites in electron transport

    • Testing of compounds that stabilize mitochondrial function

    • Evaluation of antioxidants targeting mitochondrial ROS

    • Development of biomarkers for early detection of mitochondrial dysfunction

  • Evolutionary and Ecological Implications:

    • Comparison of ND3 function across bleaching-resistant and susceptible species

    • Assessment of genetic variation in ND3 within and between populations

    • Correlation of ND3 variants with bleaching thresholds

    • Evaluation of adaptive potential through experimental evolution

This research could complement studies on other bioactive compounds from S. glaucum, such as sarcophytolide, which has demonstrated cytoprotective effects that might have parallels to cellular protection mechanisms relevant to bleaching resistance . The research approach should be systematic, with clearly defined research questions following established methodology principles .

What specialized techniques are required for purifying and stabilizing recombinant Sarcophyton glaucum ND3 for structural studies?

Purification and stabilization of recombinant S. glaucum ND3 for structural studies requires specialized approaches:

  • Advanced Purification Strategies:

    • Tandem affinity purification with cleavable tags

    • Size exclusion chromatography with in-line light scattering

    • Ion exchange chromatography under optimized salt gradients

    • Lipid-detergent mixed micelle preparation

  • Membrane Protein Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization method

    • Vapor diffusion with detergent screening

    • Microfluidic crystallization platforms

  • Stabilization for Structural Studies:

    • Nanobody or antibody fragment co-crystallization

    • Thermostabilizing mutations

    • Lipid nanodisc reconstitution

    • Fluorinated surfactants for NMR studies

  • Alternative Structural Determination Methods:

    • Cryo-electron microscopy for membrane protein complexes

    • Solid-state NMR for membrane-embedded proteins

    • Small-angle X-ray scattering for solution conformation

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

These techniques should be implemented following rigorous experimental protocols similar to those used in the characterization of other marine natural products . The methodological approach should be clearly documented and follow established research guidelines with appropriate controls and validation steps .

How can researchers effectively design experiments to investigate the interaction between recombinant Sarcophyton glaucum ND3 and other components of the respiratory chain?

Investigating interactions between S. glaucum ND3 and other respiratory chain components requires specialized experimental design:

  • Interaction Mapping Strategies:

    • Co-immunoprecipitation with antibodies against native complexes

    • Pull-down assays using tagged recombinant proteins

    • Surface plasmon resonance for binding kinetics

    • Crosslinking mass spectrometry for interaction interface identification

  • Functional Interaction Assessment:

    • Reconstitution of partial or complete respiratory complexes

    • Activity measurements of reconstituted subcomplexes

    • Electron transfer kinetics between purified components

    • Respiratory control ratio determination in reconstituted systems

  • Visualization Approaches:

    • Fluorescence resonance energy transfer (FRET) between labeled components

    • Single-particle cryo-EM of assembled complexes

    • Super-resolution microscopy of labeled components

    • Atomic force microscopy of membrane-reconstituted complexes

  • In Silico Interaction Analysis:

    • Molecular docking of S. glaucum ND3 to other Complex I components

    • Molecular dynamics simulations of assembled complexes

    • Electrostatic and hydrophobic interaction mapping

    • Evolutionary covariance analysis to predict interaction surfaces

The experimental design should follow systematic research methodology approaches with clear research questions and hypotheses that are appropriately scoped and structured . The investigation should incorporate both technical and biological replicates to ensure reproducibility and reliability of results.

What are the most effective approaches for studying the kinetics of electron transport in systems containing recombinant Sarcophyton glaucum ND3?

Studying electron transport kinetics requires specialized methodological approaches:

  • Rapid Kinetics Methods:

    • Stopped-flow spectrophotometry for millisecond reactions

    • Freeze-quench EPR for intermediate state trapping

    • Temperature-jump relaxation methods

    • Flash photolysis for photoinduced electron transfer

  • Steady-State Kinetics Approaches:

    • NADH oxidation monitoring at various substrate concentrations

    • Oxygen consumption measurements with Clark-type electrodes

    • Membrane potential measurements with voltage-sensitive dyes

    • Artificial electron acceptor reduction assays

  • Advanced Spectroscopic Techniques:

    • Time-resolved fluorescence for conformational dynamics

    • Transient absorption spectroscopy for intermediate states

    • Resonance Raman spectroscopy for active site changes

    • EPR spectroscopy for paramagnetic intermediate detection

  • Data Analysis Methods:

    • Global fitting of multi-wavelength data

    • Numerical integration of rate equations

    • Kinetic modeling with advanced software packages

    • Statistical validation of kinetic parameters

These methodological approaches should follow systematic research protocols with appropriate experimental design and controls . The kinetic studies should incorporate appropriate statistical analyses to ensure the validity and reliability of the results.

What quality control measures are essential when producing and characterizing recombinant Sarcophyton glaucum ND3 for research applications?

Quality control for recombinant S. glaucum ND3 research requires rigorous standards:

  • Expression Quality Control:

    • SDS-PAGE and Western blotting for expression verification

    • Mass spectrometry for protein identification

    • N-terminal sequencing for verification of start site

    • Yield quantification across multiple expressions

  • Purity Assessment:

    • High-resolution chromatography (multiple methods)

    • Advanced electrophoretic techniques (native PAGE, 2D-PAGE)

    • Light scattering for aggregation detection

    • Host cell protein contamination assays

  • Functional Quality Control:

    • Activity assays with defined acceptance criteria

    • Reproducibility testing across batches

    • Stability monitoring during storage

    • Dose-response consistency

  • Structural Integrity Verification:

    • Circular dichroism for secondary structure

    • Fluorescence spectroscopy for tertiary structure

    • Thermal stability measurements

    • Limited proteolysis patterns

Quality Control ParameterMethodAcceptance Criteria
PuritySE-HPLC>95% monomer peak
IdentityMass spectrometryMass within 0.1% of theoretical
ActivityNADH oxidation>80% of reference standard
Structural integrityCD spectroscopyPattern matching reference spectrum
StabilityActivity retention<10% loss after 1 week at 4°C

These quality control measures should follow standardized protocols similar to those used in other biochemical and natural product studies . The quality control procedures should be clearly documented and consistently applied across all experimental work.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.