Recombinant Sarpa salpa Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sarpa salpa Rhodopsin (rho)

Recombinant Sarpa salpa Rhodopsin (rho) is a engineered protein derived from the retina of Sarpa salpa (Salema fish), expressed in E. coli and purified for research applications. This full-length rhodopsin protein (residues 1–353) is fused with an N-terminal His-tag for facilitated purification and detection. It serves as a valuable tool for studying rhodopsin structure, function, and related pathologies, particularly in contexts involving retinal degeneration or G-protein-coupled receptor (GPCR) signaling .

Role in Retinal Degeneration Research

While Sarpa salpa rhodopsin itself is not directly implicated in human retinal diseases, recombinant variants are used to:

  • Test therapeutic compounds: Small molecule chaperones (e.g., SRD005825, YC-001) that stabilize misfolded rhodopsin mutants are often evaluated using recombinant rhodopsin models .

  • Study protein aggregation: Mutant rhodopsins prone to aggregation (e.g., P23H, G188R) are compared to wild-type controls to elucidate degeneration mechanisms .

Comparative Analysis with Human Rhodopsin

While Sarpa salpa rhodopsin shares structural homology with human rhodopsin (e.g., seven transmembrane domains), key differences include:

FeatureSarpa salpa RhodopsinHuman Rhodopsin
SourceE. coli-expressed recombinantNative human retina
TaggingHis-tag for purificationUntagged in native form
Primary UseStructural studies, assay controlsDisease modeling (e.g., retinitis pigmentosa)
Chromophore BindingRequires exogenous 11-cis-retinal in vitroEndogenous chromophore in photoreceptors

Challenges and Considerations

  • Limitations in Functional Assays: Recombinant E. coli-expressed rhodopsin lacks post-translational modifications (e.g., glycosylation) critical for full functionality .

  • Stability Concerns: Lyophilized proteins require careful reconstitution to avoid aggregation, particularly when stored at 4°C for extended periods .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Sarpa salpa (Salema)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYVPMVNTSGIVRSPYEYPQYYLVNPAAYARLGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWLMALACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFTVPLMVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVIMMVVAFLVCWLPYASVAWWIFTHQGSEFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, is essential for image-forming vision at low light intensities. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish use 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation facilitates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Sarpa salpa Rhodopsin and how does it compare to rhodopsins from other species?

Sarpa salpa Rhodopsin (Rho) is a visual pigment protein belonging to the G protein-coupled receptor (GPCR) family expressed in the Salema fish (Sarpa salpa). The full-length protein consists of 353 amino acids with the sequence beginning with MNGTEGPYFY and ending with VSSSSVSSPA .

When comparing across species, rhodopsins are generally classified into monostable and bistable categories based on the thermal stability of their active states. While specific classification of Sarpa salpa Rhodopsin is not explicitly stated in the available literature, structural comparisons with other rhodopsins would likely place it within the typical GPCR class A architecture. Similar rhodopsin proteins, like the jumping spider rhodopsin-1 (JSR1), have revealed water-mediated networks around the retinal ligand that contribute to their photosensitive properties .

The functional analysis methodology for such comparisons typically includes:

  • Sequence alignment analysis

  • Spectroscopic characterization of absorption maxima

  • Analysis of retinal binding pocket architecture

  • G protein activation assays

What methodologies are most effective for expressing and purifying recombinant Sarpa salpa Rhodopsin for structural studies?

Expression and purification of recombinant Sarpa salpa Rhodopsin requires careful optimization due to the challenges associated with membrane protein production. Based on available protocols for similar photoreceptors, the following methodological approach is recommended:

Expression System Selection:

  • E. coli expression: The recombinant Sarpa salpa Rhodopsin is successfully expressed in E. coli systems with an N-terminal His-tag for purification purposes .

  • Alternative systems: For structural studies requiring post-translational modifications, mammalian expression systems such as HEK293 GnTI⁻ cells have proven effective for other rhodopsins .

Purification Protocol:

  • Cell lysis using detergent-based methods to solubilize membrane proteins

  • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Size exclusion chromatography for further purification

  • Optional: Ion exchange chromatography for additional purity

Critical Parameters for Optimization:

  • Detergent selection is crucial for maintaining protein stability and function

  • Incorporation of retinal (typically 9-cis or 11-cis) during or after expression

  • Temperature control during expression (typically 16-20°C for membrane proteins)

  • Utilization of protease inhibitors throughout purification

The resulting purified protein should achieve >90% purity as determined by SDS-PAGE analysis . For long-term storage, lyophilization or storage at -80°C in buffer containing 50% glycerol is recommended to maintain protein stability.

How do the retinal binding properties of Sarpa salpa Rhodopsin compare to bistable and monostable rhodopsins, and what methodologies reveal these differences?

The retinal binding properties of rhodopsins are fundamental to their photosensitivity and classification as either monostable or bistable. While specific experimental data for Sarpa salpa Rhodopsin is limited, comparative analysis methodologies can be applied based on research with other rhodopsins:

Comparative Spectroscopic Analysis:
The jumping spider isorhodopsin-1 (JSiR1) reconstituted with 9-cis retinal exhibits an absorbance maximum at 505 nm, while the native 11-cis retinal-bound form shows an absorbance maximum at 535 nm . Similar spectroscopic characterization of Sarpa salpa Rhodopsin with different retinal isomers would provide valuable insights into its photochemical properties.

Water-Mediated Network Analysis:
Bistable rhodopsins such as JSR1 show distinctive water-mediated networks around the retinal ligand that differ from monostable rhodopsins like bovine rhodopsin. These networks are hypothesized to contribute to the stability of different conformational states .

Methodology for Comparative Analysis:

  • UV-Vis spectroscopy of purified protein with different retinal isomers

  • Thermal stability assays to determine activation energy barriers

  • X-ray crystallography or cryo-EM to resolve water molecule positions

  • Molecular dynamics simulations to predict conformational changes

The "activation-ready" conformation observed in bistable rhodopsins compared to the more constrained structure of monostable rhodopsins is an important structural difference that affects retinal binding and photoisomerization dynamics .

What are the optimal storage and handling conditions for recombinant Sarpa salpa Rhodopsin to maintain functional integrity?

Maintaining the functional integrity of recombinant Sarpa salpa Rhodopsin requires careful attention to storage and handling conditions to prevent denaturation and loss of retinal binding capacity. Based on established protocols, the following technical guidelines are recommended:

Storage Recommendations:

  • Primary storage: -20°C to -80°C

  • Working aliquot storage: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which compromise protein stability

Buffer Composition:

  • Tris/PBS-based buffer system

  • Inclusion of 6% trehalose as a stabilizing agent

  • Maintenance of pH 8.0 for optimal stability

Reconstitution Protocol:

  • Briefly centrifuge vial prior to opening

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to minimize future freeze-thaw cycles

Special Handling Considerations:

  • Minimize exposure to bright light, especially blue wavelengths

  • Perform manipulations under dim red light when possible

  • Monitor protein stability using absorbance spectra to ensure chromophore integrity

Adherence to these guidelines will help maintain the functional and structural integrity of the recombinant protein for experimental applications.

What methodological approaches are most effective for studying rhodopsin trafficking pathways in photoreceptor cells, and how might these be applied to Sarpa salpa Rhodopsin?

Studying rhodopsin trafficking pathways requires specialized techniques that preserve cellular architecture while allowing for high-resolution visualization. Recent advances in super-resolution microscopy have provided valuable insights that could be applied to Sarpa salpa Rhodopsin:

Super-Resolution Mapping Methodology:
Recent studies of rod photoreceptors have employed super-resolution fluorescence microscopy combined with optimized retinal immunolabeling techniques to analyze rhodopsin trafficking at the single-molecule level .

Sample Preparation Protocol:

  • Retinal tissue preparation using peeling techniques to improve reagent penetration

  • Iterative adherence to filter paper to physically detach outer segments

  • Validation of inner segment enrichment through western blotting

  • Immunolabeling with specific antibodies targeting rhodopsin and trafficking markers

Imaging and Analysis Approaches:

  • Structured Illumination Microscopy (SIM) with 3D deconvolution for improved signal-to-noise ratio

  • STORM (Stochastic Optical Reconstruction Microscopy) for single-molecule localization

  • Colocalization analysis with markers of transport vesicles

Application to Sarpa salpa Rhodopsin:
To apply these methods to Sarpa salpa Rhodopsin, researchers would need to:

  • Develop specific antibodies against Sarpa salpa Rhodopsin or use epitope tagging approaches

  • Adapt tissue preparation techniques for fish retinal architecture

  • Optimize immunolabeling protocols for the specific cellular context

  • Perform comparative analyses with known trafficking markers

Using these approaches, researchers could identify whether Sarpa salpa Rhodopsin utilizes inner segment plasma membrane trafficking similar to that observed in mouse rod photoreceptors .

What are the potential applications of recombinant Sarpa salpa Rhodopsin in optogenetic tools and how would functionality be validated?

Recombinant Sarpa salpa Rhodopsin represents a potentially valuable addition to the optogenetic toolkit due to its photosensitive properties. Developing such applications would require:

Optogenetic Tool Development Approach:

  • Characterization of spectral sensitivity and photocycle kinetics

  • Engineering of fusion constructs with cellular targeting sequences

  • Development of expression vectors for mammalian neurons or other target cells

  • Optimization of light activation parameters

Functionality Validation Methodology:

  • Electrophysiological validation: Patch-clamp recordings to measure light-induced currents

  • Calcium imaging: To assess secondary signaling responses

  • Behavioral assays: In transgenic animal models expressing the rhodopsin

Comparative Analysis with Existing Optogenetic Tools:

PropertyRecombinant Sarpa salpa RhodopsinChannelrhodopsin-2Bacteriorhodopsin
FunctionGPCR signalingIon channelProton pump
Activation wavelengthTo be determined~470 nm (blue)~570 nm (green)
Temporal resolutionLikely milliseconds to secondsMillisecondsMilliseconds
Downstream effectorsG protein cascadesDirect ion fluxProton gradient

The bistable nature of some fish rhodopsins might offer advantages for applications requiring sustained activation with minimal light exposure, potentially reducing phototoxicity in experimental systems .

How does Sarpa salpa's ecological context and seasonal toxicity relate to rhodopsin function, and what research methodologies would elucidate these connections?

An intriguing aspect of Sarpa salpa research involves the fish's reported hallucinatory effects when consumed, particularly during autumn . Exploring potential connections between this phenomenon and rhodopsin function presents a fascinating interdisciplinary research direction:

Ecological Context Analysis:
Sarpa salpa shows seasonal variation in toxicity related to its diet, particularly the consumption of toxic dinoflagellates that live as epiphytes on Posidonia oceanica leaves . The correlation between seasonal patterns of toxicity and potential adaptation in visual systems could be investigated.

Methodological Approach to Connecting Toxicity and Visual Function:

  • Seasonal comparative analysis of rhodopsin expression levels

  • Investigation of potential molecular interactions between accumulated toxins and visual pigments

  • Evaluation of spectral sensitivity changes in response to environmental toxins

  • Assessment of rhodopsin stability in the presence of identified neurotoxins

Experimental Design Framework:

  • Temporal sampling across seasons with standardized collection parameters

  • Parallel analysis of toxin accumulation and rhodopsin characteristics

  • Controlled exposure studies using isolated retinal tissue

  • Molecular dynamics simulations to predict toxin-protein interactions

Toxicity and Oxidative Stress Correlation:
Research has shown a significant correlation (P < 0.05) between toxic dinoflagellate abundance and levels of TBARS (an oxidative stress marker) in Sarpa salpa tissues . Investigating whether similar oxidative stress affects rhodopsin function could yield insights into both the visual biology and toxicity mechanisms of this species.

Understanding these relationships would not only advance our knowledge of rhodopsin biochemistry but also provide ecological insights into the adaptive significance of visual system modifications in response to seasonal dietary changes.

What analytical techniques would best characterize the G protein coupling specificity of Sarpa salpa Rhodopsin, and how might this inform our understanding of GPCR evolution?

Characterizing the G protein coupling specificity of Sarpa salpa Rhodopsin requires sophisticated biochemical and biophysical techniques. Based on approaches used with other rhodopsins, the following methodological framework is recommended:

G Protein Coupling Analysis Techniques:

  • In vitro GTPγS binding assays with purified G proteins to measure activation rates

  • BRET (Bioluminescence Resonance Energy Transfer) to monitor real-time interactions

  • Cellular calcium and cAMP assays to determine downstream signaling pathways

  • Molecular docking and MD simulations to predict interaction interfaces

Comparative Analysis Framework:
Studies of jumping spider rhodopsin-1 have indicated promiscuity in G protein recognition, a characteristic often observed in other class A GPCRs . A similar analysis of Sarpa salpa Rhodopsin would contribute to our understanding of GPCR coupling evolution.

Evolutionary Analysis Methodology:

  • Sequence alignment of intracellular loops across species

  • Ancestral state reconstruction to infer evolutionary transitions

  • Selection pressure analysis on G protein interface residues

  • Correlation of coupling profiles with habitat and behavioral adaptations

Research Questions Addressing Evolution:

  • Does Sarpa salpa Rhodopsin show higher G protein promiscuity compared to mammalian rhodopsins?

  • Are there specific adaptive mutations in the G protein interaction interface?

  • How does coupling specificity correlate with the spectral tuning of the receptor?

Understanding the G protein coupling profile would provide insights into how visual signaling has evolved in marine vertebrates and potentially reveal novel signaling mechanisms that could inform drug discovery targeting other GPCRs.

What are the most common challenges in recombinant rhodopsin expression systems, and how can researchers overcome them when working with Sarpa salpa Rhodopsin?

Recombinant expression of rhodopsins presents several technical challenges that researchers should anticipate when working with Sarpa salpa Rhodopsin:

Common Technical Challenges and Solutions:

ChallengeDescriptionTroubleshooting Approach
Low expression yieldMembrane proteins often express poorlyOptimize codon usage, reduce expression temperature to 16-20°C, use specialized strains (e.g., C41/C43)
Protein misfoldingIncorrect folding in heterologous systemsInclude molecular chaperones, optimize detergent selection, consider fusion partners (e.g., MBP, SUMO)
Chromophore incorporationInefficient retinal bindingAdd retinal during expression or reconstitute post-purification, protect from light
AggregationFormation of non-functional aggregatesScreen buffer conditions, add stabilizing agents (glycerol, trehalose), use mild detergents
Proteolytic degradationLoss of integrity during purificationAdd protease inhibitors, reduce purification time, optimize pH and temperature

Methodological Approaches to Improve Success:

  • Expression system selection: While E. coli has been used successfully , mammalian systems like HEK293 GnTI⁻ provide post-translational modifications that may improve folding

  • Fusion tags optimization: Beyond the standard His-tag, consider testing multiple tag positions and types

  • Detergent screening: Systematic testing of detergent types and concentrations using thermal stability assays

  • Lipid supplementation: Addition of specific lipids during purification to maintain native-like environment

These approaches should be applied systematically, with careful documentation of conditions and outcomes to optimize protocols specifically for Sarpa salpa Rhodopsin.

How can researchers effectively analyze and interpret conflicting data from different analytical techniques when characterizing Sarpa salpa Rhodopsin?

Conflicting data from different analytical techniques is a common challenge in rhodopsin research due to the complex nature of these proteins and their sensitivity to experimental conditions. A systematic approach to resolving such conflicts includes:

Data Conflict Resolution Framework:

  • Technique-specific limitations assessment:

    • Evaluate inherent biases of each method (e.g., detergent effects on spectroscopic properties)

    • Consider time resolution disparities between techniques

    • Assess native vs. non-native conditions in different assays

  • Hierarchical data integration strategy:

    • Prioritize techniques based on proximity to native conditions

    • Develop mathematical models that account for methodological differences

    • Use orthogonal techniques to validate key findings

  • Controlled variable experiments:

    • Systematically vary one parameter while keeping others constant

    • Create experimental matrices to identify condition-dependent effects

    • Use internal standards and controls across all experiments

Case Study Approach:
When faced with conflicting data, researchers should:

  • Document all experimental conditions meticulously

  • Compare results with structurally similar rhodopsins

  • Consider intermediate states that might explain discrepancies

  • Develop hypotheses that reconcile seemingly contradictory results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.