Recombinant Scaphirhynchus platorynchus Cytochrome c oxidase subunit 1 (mt-co1)

What is Cytochrome c oxidase subunit 1 in Scaphirhynchus platorynchus?

Cytochrome c oxidase subunit 1 (mt-co1) is a mitochondrial protein found in the Scaphirhynchus platorynchus (Shovelnose sturgeon). It functions as a component of the electron transport chain in cellular respiration. The protein is encoded by the mitochondrial genome (gene name: mt-co1, with synonyms coi, coxi, mtco1) and has the UniProt accession number P29654. The enzyme belongs to the oxidoreductase class with EC number 1.9.3.1 and is alternatively known as Cytochrome c oxidase polypeptide I .

What is the amino acid sequence of Shovelnose sturgeon mt-co1?

The amino acid sequence of the Scaphirhynchus platorynchus Cytochrome c oxidase subunit 1 (partial) is: FWFFGHPEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWDTPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMG. This sequence represents a functional region of the protein and contains key structural domains important for the protein's catalytic activity in the electron transport chain .

How is recombinant Scaphirhynchus platorynchus mt-co1 produced?

Recombinant Scaphirhynchus platorynchus mt-co1 is typically produced in Escherichia coli (E. coli) expression systems. The process involves cloning the mt-co1 gene sequence (or partial sequence) into an appropriate expression vector, transforming the vector into E. coli, inducing protein expression, and then purifying the recombinant protein. Quality control typically includes SDS-PAGE analysis to confirm purity (>85% according to available products) . The recombinant protein may include a tag to facilitate purification, though the specific tag type is determined during the manufacturing process to optimize for protein stability and function .

What are the optimal storage conditions for recombinant Scaphirhynchus platorynchus mt-co1?

For optimal stability and activity, recombinant Scaphirhynchus platorynchus mt-co1 should be stored at -20°C or -80°C. The protein is typically available in two forms: liquid and lyophilized. The liquid form has a shelf life of approximately 6 months when stored at -20°C/-80°C, while the lyophilized form maintains stability for up to 12 months at the same temperatures. To avoid protein degradation, repeated freeze-thaw cycles should be minimized. For short-term use, working aliquots can be stored at 4°C for up to one week .

How should recombinant Scaphirhynchus platorynchus mt-co1 be reconstituted for experimental use?

For proper reconstitution of lyophilized recombinant Scaphirhynchus platorynchus mt-co1, the vial should first be briefly centrifuged to bring the contents to the bottom. The protein should then be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage of the reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being a standard recommendation) and then aliquot the solution for storage at -20°C/-80°C. This glycerol addition helps prevent freeze-damage to the protein structure and maintains enzymatic activity over extended storage periods .

What experimental controls should be included when studying Scaphirhynchus platorynchus mt-co1?

When designing experiments involving recombinant Scaphirhynchus platorynchus mt-co1, several controls should be implemented:

• Negative controls: Buffer-only or irrelevant protein samples to establish baseline measurements

• Positive controls: Known functional Cytochrome c oxidase samples from well-characterized species

• Activity controls: Standard substrate reactions to verify enzymatic function

• Specificity controls: Reactions with competitive inhibitors to confirm binding site specificity

• Temperature controls: Parallel assays at various temperatures to determine optimal conditions, considering the native temperature range of 10°C-20°C for the Shovelnose sturgeon

• Storage-time controls: Freshly prepared versus stored protein samples to account for potential activity loss over time

How can recombinant Scaphirhynchus platorynchus mt-co1 be utilized in comparative evolutionary studies?

Recombinant Scaphirhynchus platorynchus mt-co1 can serve as a valuable tool in evolutionary studies due to the conservation of Cytochrome c oxidase across species. Researchers can perform comparative analyses between the Shovelnose sturgeon mt-co1 and corresponding proteins from related species such as the federally endangered pallid sturgeon (Scaphirhynchus albus). Such studies might include:

• Sequence homology analysis to determine evolutionary relationships

• Structural modeling to identify conserved functional domains

• Enzyme kinetics comparisons to detect adaptive changes

• Site-directed mutagenesis to investigate the functional significance of amino acid substitutions

• Habitat-specific adaptations in cytochrome c oxidase function, particularly relevant given the fluvial specialist nature of Scaphirhynchus species and their adaptation to specific river velocity profiles

These approaches can provide insights into evolutionary adaptations in energy metabolism across species with different ecological niches and conservation statuses .

What analytical techniques are most effective for studying conformational changes in Scaphirhynchus platorynchus mt-co1?

Several advanced analytical techniques can be employed to study conformational changes in recombinant Scaphirhynchus platorynchus mt-co1:

When selecting appropriate techniques, researchers should consider the specific research question, available equipment, and the physicochemical properties of the recombinant protein .

How can recombinant mt-co1 contribute to conservation efforts for Scaphirhynchus platorynchus?

Recombinant Scaphirhynchus platorynchus mt-co1 can be used as a molecular tool in conservation biology through several applications:

• Development of species-specific antibodies for population monitoring

• Creation of standard reference materials for environmental DNA (eDNA) assays

• Comparative studies with endangered relatives like Scaphirhynchus albus (pallid sturgeon)

• Investigation of molecular adaptations to environmental stressors

• Assessment of mitochondrial function across different populations to identify potential genetic bottlenecks

These applications can help researchers understand the physiological adaptations of Shovelnose sturgeon to their freshwater, demersal, potamodromous lifestyle in temperate climates (10°C-20°C). Such information is critical for developing effective conservation strategies, particularly considering the threatened status of related sturgeon species .

What insights can mt-co1 provide about the behavioral adaptations of Scaphirhynchus platorynchus to flow environments?

The mt-co1 protein plays a crucial role in cellular energy production, which directly influences swimming performance and behavioral adaptations of Scaphirhynchus platorynchus to variable flow environments. Research has shown that Shovelnose sturgeon exhibit specific behavioral responses to heterogeneous flow fields, with downstream movement being more common than station holding or upstream movement. These behaviors correlate with water velocity, suggesting adaptation to energy-efficient movement strategies in their native river habitats.

Studies on different life stages (juvenile and subadult) have revealed that larger fish show increased upstream movement capability, indicating life-stage-specific energy utilization strategies. The molecular efficiency of mt-co1 may be directly related to these observed behavioral patterns. Investigating the enzyme kinetics of recombinant mt-co1 under various temperature and pH conditions that mimic different river environments could provide valuable insights into the physiological basis of these behavioral adaptations .

What are common challenges in expressing functional recombinant Scaphirhynchus platorynchus mt-co1 and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Scaphirhynchus platorynchus mt-co1:

• Protein Solubility Issues: Membrane proteins like mt-co1 often have hydrophobic regions that can cause aggregation.

  • Solution: Optimize expression conditions by testing different detergents, use fusion tags that enhance solubility, or explore refolding protocols from inclusion bodies.

• Post-translational Modification Differences: E. coli-expressed proteins lack eukaryotic post-translational modifications.

  • Solution: Consider alternative expression systems like insect cells or yeast for applications where native-like modifications are critical.

• Activity Loss During Purification: The multi-subunit nature of Cytochrome c oxidase can lead to activity loss when expressing just one subunit.

  • Solution: Implement gentle purification methods, include stabilizing agents like glycerol, and maintain recommended temperature conditions throughout the purification process.

• Protein Degradation: Recombinant proteins can be subject to proteolytic degradation.

  • Solution: Include protease inhibitors during purification and store with proper buffer components at recommended temperatures (-20°C/-80°C) .

How can researchers validate the functional activity of recombinant Scaphirhynchus platorynchus mt-co1?

Validating the functional activity of recombinant Scaphirhynchus platorynchus mt-co1 requires multiple approaches:

• Spectrophotometric Assays: Monitor the oxidation of reduced cytochrome c, which is coupled to oxygen consumption.

  • Expected results: Active mt-co1 will show characteristic absorption changes at 550 nm.

• Oxygen Consumption Measurements: Use oxygen electrodes to directly measure oxygen consumption rates.

  • Expected results: Functional mt-co1 will demonstrate oxygen consumption in the presence of appropriate substrates.

• Electron Transfer Activity: Assess electron transfer capability using artificial electron acceptors.

  • Expected results: Active enzyme will transfer electrons at rates comparable to native enzyme preparations.

• Thermal Stability Assays: Evaluate activity retention after exposure to various temperatures.

  • Expected results: The protein should maintain activity within the 10°C-20°C range typical for the species' natural environment .

• Inhibitor Sensitivity Tests: Measure activity in the presence of known Cytochrome c oxidase inhibitors.

  • Expected results: Characteristic inhibition patterns should match those of native enzyme .

What bioinformatic approaches are most useful for analyzing Scaphirhynchus platorynchus mt-co1 in relation to other species?

Several bioinformatic approaches can be employed to analyze Scaphirhynchus platorynchus mt-co1 in relation to other species:

• Sequence Alignment and Phylogenetic Analysis: Tools like MUSCLE, CLUSTAL, or MAFFT can align mt-co1 sequences across species, followed by phylogenetic tree construction using methods such as Maximum Likelihood or Bayesian inference to establish evolutionary relationships.

• Protein Structure Prediction: Homology modeling using platforms like SWISS-MODEL or I-TASSER can predict three-dimensional structures based on known structures of homologous proteins from other species.

• Molecular Dynamics Simulations: Software like GROMACS or AMBER can simulate protein behavior in different environments, providing insights into functional differences between species.

• Selection Pressure Analysis: Tools like PAML can detect sites under positive selection, revealing adaptively evolving residues that may be associated with species-specific functions.

• Functional Motif Identification: Programs like MEME or PROSITE can identify conserved functional motifs across species, highlighting critical regions for enzyme function .

These approaches can help researchers understand the evolutionary history and functional adaptations of mt-co1 in Scaphirhynchus platorynchus compared to related species like the pallid sturgeon (Scaphirhynchus albus) .

What are promising future research applications for recombinant Scaphirhynchus platorynchus mt-co1?

Several promising future research directions for recombinant Scaphirhynchus platorynchus mt-co1 include:

• Environmental Adaptation Studies: Investigating how mt-co1 variants adapt to changing river conditions, particularly in light of climate change and anthropogenic modifications to river systems.

• Biomarker Development: Utilizing mt-co1-specific antibodies or molecular probes for non-invasive monitoring of Shovelnose sturgeon populations through environmental DNA (eDNA) methods.

• Comparative Energetics Research: Exploring differences in energy metabolism between endangered and non-endangered sturgeon species to understand physiological factors in population decline.

• Molecular Evolution Analysis: Conducting detailed molecular clock studies of mt-co1 to establish divergence times among Acipenseridae family members.

• Flow Adaptation Mechanisms: Correlating molecular function of mt-co1 with the observed behavioral adaptations to flow environments, particularly the preference for downstream movement and station holding behaviors noted in experimental studies .

• Conservation Genetics Applications: Developing genetic tools based on mt-co1 sequence variation for population management and breeding programs .

How might recombinant mt-co1 contribute to understanding the physiological basis of behavioral adaptations in Scaphirhynchus sturgeons?

Recombinant mt-co1 can serve as a valuable tool for understanding the physiological basis of behavioral adaptations in Scaphirhynchus sturgeons through several experimental approaches: