Recombinant Scheffersomyces stipitis Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

What is Scheffersomyces stipitis AIM31 and what are its known functions?

Scheffersomyces stipitis AIM31, also known as RCF1 (Respiratory supercomplex factor 1), is a 131-amino acid mitochondrial protein involved in mitochondrial inheritance and respiratory function. The protein is encoded by the RCF1 gene (PICST_36309) and plays a crucial role in the organization of mitochondrial respiratory chain complexes .

S. stipitis, unlike the Crabtree-positive Saccharomyces cerevisiae, is a Crabtree-negative yeast with a predominantly respiratory metabolism regardless of glucose concentration. This metabolic characteristic makes AIM31 particularly important in maintaining mitochondrial function in this organism . The protein is believed to contribute to the respiratory efficiency that allows S. stipitis to ferment pentose sugars, a distinctive metabolic feature of this yeast.

How does AIM31 compare structurally and functionally between Scheffersomyces stipitis and other yeast species?

AIM31 belongs to a conserved family of mitochondrial proteins found across various yeast species. The S. stipitis AIM31 shares significant homology with related proteins in other yeasts, particularly in the C-terminal domain which is critical for its function.

The amino acid sequence of S. stipitis AIM31 (MVIRSKEQPVVPLGALATTGAIILAARSMKRGEKLRTQVYFRYRVVFQLITLVALVAGGVMMQQESAEQKKTREDKLREKAKQREKLWIEELERRDALIQERKRRLEESRAELKKMAEEGFKQENDNSKGK) contains structural motifs typical of mitochondrial membrane proteins, suggesting its localization and function in mitochondrial membranes .

What is the relationship between AIM31 and mitochondrial programmed cell death pathways?

While direct evidence linking S. stipitis AIM31 to programmed cell death (PCD) is limited in the provided resources, research on mitochondrial proteins in related yeasts suggests potential involvement in PCD regulation. Mitochondrial proteins play critical roles in PCD in yeasts, particularly through cytochrome c release mechanisms.

In S. cerevisiae, mitochondria are implicated in acetic acid-induced PCD, with cytochrome c release from mitochondria to the cytosol serving as a key event . Given the conserved nature of mitochondrial respiratory components across yeast species, AIM31 might participate in similar pathways in S. stipitis, potentially influencing mitochondrial membrane integrity or respiratory chain organization during stress responses.

Research has demonstrated that yeast strains with mutations affecting mitochondrial respiratory chain function show altered susceptibility to PCD, further suggesting that proteins like AIM31 that maintain respiratory function could indirectly modulate cell death pathways .

What are the optimal conditions for expressing recombinant S. stipitis AIM31 protein in heterologous systems?

For optimal expression of recombinant S. stipitis AIM31, E. coli has proven to be an effective heterologous expression system. The recommended approach involves:

• Expression construct design: The full-length protein (amino acids 1-131) should be fused to an N-terminal His tag to facilitate purification while maintaining protein function .

• Expression conditions: Standard E. coli expression systems with IPTG induction have shown good protein yields. Optimal induction should occur at OD600 of 0.6-0.8, with 0.5-1.0 mM IPTG at 25-30°C for 4-6 hours to balance yield with proper folding.

• Protein solubility considerations: As a mitochondrial protein, AIM31 contains hydrophobic regions that may affect solubility. Including mild detergents (0.1-0.5% Triton X-100 or equivalent) in lysis buffers can improve extraction efficiency.

• Purification approach: Affinity chromatography using Ni-NTA resin is effective for purifying His-tagged AIM31. Elution with 250-300 mM imidazole typically yields protein with >90% purity .

The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability. For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C/-80°C is recommended .

How can researchers effectively study AIM31 protein-protein interactions in mitochondrial systems?

To study AIM31 protein-protein interactions in mitochondrial systems, researchers should consider these methodological approaches:

• Co-immunoprecipitation (Co-IP): Using anti-His tag antibodies for the recombinant protein, or developing specific antibodies against AIM31, researchers can pull down the protein complex from isolated mitochondria and identify interacting partners by mass spectrometry.

• Proximity labeling approaches: BioID or APEX2 fusion proteins can be created to identify proteins in close proximity to AIM31 in intact mitochondria, providing spatial context for interactions.

• Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can be employed to screen for potential interacting partners, particularly focusing on other mitochondrial proteins.

• Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry can capture transient interactions and provide structural information about the interaction interfaces.

• Fluorescence microscopy: Fluorescently tagged versions of AIM31 can be used to visualize colocalization with other mitochondrial proteins, particularly in the context of mitochondrial inheritance studies.

When designing these experiments, researchers should consider the native mitochondrial environment and the potential impact of membrane association on protein interactions. Using isolated mitochondria rather than whole-cell lysates will enrich for relevant interactions and reduce false positives.

What approaches are recommended for analyzing AIM31 localization and dynamics within mitochondria?

To analyze AIM31 localization and dynamics within mitochondria, researchers should implement the following strategies:

• Subcellular fractionation: Isolate mitochondria using differential centrifugation followed by further subfractionation to separate outer membrane, inner membrane, and matrix fractions. Western blotting can then determine the specific submitochondrial localization of AIM31.

• Immunogold electron microscopy: Using specific antibodies against AIM31 with gold-conjugated secondary antibodies can precisely localize the protein at the ultrastructural level within mitochondria.

• Fluorescence microscopy approaches:

  • Construct GFP-tagged AIM31 for live-cell imaging

  • Use MitoTracker dyes to confirm mitochondrial colocalization

  • Apply super-resolution microscopy techniques (STED, PALM, or STORM) for detailed localization

• Dynamics analysis:

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

  • Photoactivatable fluorescent proteins to track movement within mitochondrial subcompartments

  • Time-lapse imaging during mitochondrial fission/fusion events or inheritance processes

• Protein topology analysis: Protease protection assays using isolated mitochondria can determine which portions of AIM31 are exposed to different mitochondrial compartments.

When studying mitochondrial dynamics, researchers should consider the unique respiratory metabolism of S. stipitis compared to other yeasts like S. cerevisiae, as this may influence AIM31 behavior and localization patterns .

How can researchers effectively measure the impact of AIM31 on mitochondrial respiration in yeast systems?

To assess AIM31's impact on mitochondrial respiration in yeast systems, researchers can employ these methodological approaches:

• Oxygen consumption measurements:

  • High-resolution respirometry using instruments like Oroboros Oxygraph-2k

  • Clark-type oxygen electrode measurements with isolated mitochondria

  • Whole-cell respiration assays in wild-type vs. AIM31 knockout strains

• Mitochondrial membrane potential analysis:

  • Fluorescent dyes such as JC-1, TMRM, or DiOC6(3) to assess membrane potential

  • Flow cytometry for quantitative analysis across cell populations

  • Live-cell imaging for temporal dynamics of membrane potential changes

• Respiratory chain complex activity assays:

  • Spectrophotometric measurement of individual complex activities (I-IV)

  • Blue native PAGE to assess respiratory supercomplex assembly

  • In-gel activity assays for specific respiratory complexes

• Metabolic flux analysis:

  • 13C-based flux analysis to trace carbon flow through respiratory pathways

  • Measurement of NAD+/NADH ratios as indicators of respiratory activity

  • Extracellular flux analysis to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

• ROS production measurement:

  • Fluorescent probes like MitoSOX Red or CM-H2DCFDA

  • EPR spectroscopy for direct detection of specific ROS species

  • Mitochondria-targeted redox sensors for compartment-specific ROS detection

When designing these experiments, researchers should consider S. stipitis' naturally high respiratory capacity compared to Crabtree-positive yeasts, which might mask subtle effects of AIM31 manipulation . Comparing respiratory parameters under different carbon sources and oxygen conditions will provide more comprehensive functional insights.

What genetic manipulation strategies are most effective for studying AIM31 function in Scheffersomyces stipitis?

For genetic manipulation of AIM31 in S. stipitis, researchers should consider these approaches:

• Gene deletion/knockout strategies:

  • Homologous recombination-based gene replacement with selection markers

  • CRISPR-Cas9 system adapted for S. stipitis, with appropriate codon optimization

  • Conditional expression systems (e.g., tetracycline-regulated) for essential genes

• Site-directed mutagenesis approaches:

  • Target conserved residues identified through sequence alignment with homologs

  • Focus on potentially functional domains based on structural predictions

  • Create phosphomimetic mutations at predicted phosphorylation sites

• Expression modulation:

  • Promoter replacement for controlled expression levels

  • Antisense RNA or RNAi-based knockdown strategies

  • Degron-tag systems for inducible protein depletion

• Complementation studies:

  • Cross-species complementation with AIM31 homologs from other yeasts

  • Domain swapping between species to identify functional regions

  • Rescue experiments with mutated versions to identify essential residues

• Reporter systems:

  • Fusion with fluorescent proteins for localization and expression studies

  • Split reporter systems for interaction studies

  • Transcriptional reporters for regulatory studies

When working with S. stipitis, researchers should note that transformation efficiencies are typically lower than in S. cerevisiae, and homologous recombination may be less efficient. Optimizing transformation protocols with species-specific adjustments and including longer homology arms (500-1000 bp) can improve genetic manipulation success rates.

How does AIM31 interact with the proteasome system, and what methods can be used to study this relationship?

The relationship between AIM31 and the proteasome system represents an important area of investigation, particularly given the role of proteasome regulation in mitochondrial protein quality control. Based on available information about related mitochondrial proteins, researchers can employ these approaches:

• Protein stability and turnover analysis:

  • Cycloheximide chase experiments to measure AIM31 half-life

  • Proteasome inhibitor treatments (e.g., bortezomib) to assess stabilization

  • Ubiquitination analysis through immunoprecipitation and ubiquitin-specific antibodies

• Direct interaction studies with proteasome components:

  • Yeast two-hybrid screening against proteasome subunits

  • Co-immunoprecipitation with proteasomal proteins

  • Proximity labeling approaches to identify spatial relationships

• Functional impact assessment:

  • Measure AIM31 levels in proteasome mutant backgrounds

  • Assess mitochondrial function in cells with altered proteasome activity

  • Evaluate the impact of AIM31 mutations on proteasomal degradation susceptibility

• Potential relationship with PI31/Fub1:

  • Given that PI31 (also known as Fub1 in yeast) is a proteasome inhibitor that affects multiple active sites , researchers should investigate potential functional relationships with AIM31

  • Compare phenotypes of AIM31 and PI31/Fub1 mutants

  • Assess co-localization or interaction between these proteins

Researchers should note that proteasome components may exhibit different properties between yeast species . Therefore, studies should incorporate species-specific controls and consider evolutionary conservation when interpreting results between S. stipitis and model organisms like S. cerevisiae.

How does AIM31 from S. stipitis compare functionally with homologs in other yeast species, and what methods are best for comparative studies?

Conducting effective comparative studies of AIM31 across yeast species requires multiple complementary approaches:

• Sequence-based comparative analysis:

  • Multiple sequence alignment to identify conserved domains and residues

  • Phylogenetic analysis to establish evolutionary relationships

  • Protein structure prediction and comparison across species

• Cross-species functional complementation:

  • Express S. stipitis AIM31 in other yeast species with AIM31/RCF1 deletions

  • Test for rescue of phenotypes related to mitochondrial function

  • Quantify the degree of functional conservation through growth, respiration, and other relevant assays

• Biochemical comparison methodologies:

  • Side-by-side activity assays of recombinant proteins from different species

  • Substrate specificity analysis

  • Protein-protein interaction profiles across species

• Localization and expression pattern comparison:

  • Immunofluorescence or fluorescent protein tagging to compare subcellular distribution

  • qRT-PCR or RNA-seq to compare expression patterns under various conditions

  • Promoter analysis to identify conserved regulatory elements

Research has shown that S. stipitis has a unique respiratory metabolism compared to Crabtree-positive yeasts like S. cerevisiae, maintaining fully respiratory metabolism under both glucose-limited and glucose-excess conditions . This metabolic difference provides an important context for understanding potential functional differences in AIM31 between these species.

Interestingly, the conservation of function across species extends to proteasome regulation, where human PI31 can complement yeast fub1Δ mutants, suggesting evolutionary conservation of certain mitochondrial regulatory mechanisms . Similar cross-species complementation approaches could be valuable for studying AIM31 function.

What metabolomic approaches can reveal the impact of AIM31 on S. stipitis metabolism compared to other yeast species?

To investigate AIM31's impact on S. stipitis metabolism through metabolomics, researchers should consider:

• Untargeted metabolomics approaches:

  • LC-MS/MS or GC-MS profiling of global metabolite changes in AIM31 mutants

  • Multivariate statistical analysis (PCA, PLS-DA) to identify metabolic signatures

  • Pathway enrichment analysis to identify most affected metabolic processes

• Targeted metabolic analyses:

  • Focus on TCA cycle intermediates as indicators of respiratory metabolism

  • Analyze respiratory chain cofactors (NAD+/NADH, FAD/FADH2)

  • Measure ATP/ADP ratios and energy charge

• Flux analysis approaches:

  • 13C-based metabolic flux analysis to trace carbon flow

  • Isotopomer distribution analysis to identify altered pathway activities

  • Dynamic flux measurements under changing nutrient conditions

• Comparative experimental design:

  • Parallel analysis of S. stipitis and S. cerevisiae under identical conditions

  • Include both glucose-limited and glucose-excess conditions to highlight Crabtree effect differences

  • Examine metabolic responses to oxygen limitation, which triggers fermentation in S. stipitis unlike glucose excess in S. cerevisiae

S. stipitis shows different patterns of intracellular metabolites compared to S. cerevisiae despite similar respiratory capacity under certain conditions . This suggests that metabolomic analysis of AIM31 mutants might reveal specific adaptations related to pentose sugar metabolism or respiratory preference that distinguish S. stipitis from other yeasts.

How can transcriptomic approaches illuminate the regulatory network surrounding AIM31 in S. stipitis compared to other yeasts?

Transcriptomic approaches offer powerful insights into the regulatory context of AIM31. Researchers should implement:

• RNA sequencing experimental design:

  • Compare wild-type and AIM31 knockout/knockdown strains

  • Include multiple growth conditions (aerobic/anaerobic, different carbon sources)

  • Perform time-course analysis during metabolic shifts

• Differential expression analysis:

  • Identify genes directly affected by AIM31 perturbation

  • Focus on mitochondrial genes and respiratory pathways

  • Compare with homologous perturbations in other yeast species

• Regulatory network reconstruction:

  • Use transcription factor analysis to identify potential regulators of AIM31

  • Construct gene regulatory networks through coexpression analysis

  • Compare network topology between S. stipitis and other yeasts

• Integrative approaches:

  • Combine transcriptomics with ChIP-seq to identify direct transcription factor binding

  • Integrate proteomics data to account for post-transcriptional regulation

  • Correlate expression patterns with metabolomic changes

Research has shown that genes involved in central metabolic pathways exhibit different expression patterns between S. stipitis and S. cerevisiae, suggesting distinct regulatory networks . When analyzing transcriptomic data, researchers should focus on identifying shared and unique transcription factor families between the yeasts, as these differences may explain the contrasting regulation of glycolytic and gluconeogenic pathways.

What are the implications of AIM31 research for understanding mitochondrial inheritance mechanisms in diverse yeast species?

Research on AIM31 has significant implications for understanding broader mitochondrial inheritance mechanisms:

• Evolutionary conservation of mitochondrial inheritance pathways:

  • AIM31's role in S. stipitis provides a comparative model to the better-studied S. cerevisiae systems

  • Analysis of functional conservation versus divergence helps identify core inheritance machinery versus species-specific adaptations

  • Insights from comparative studies can illuminate general principles of mitochondrial inheritance across eukaryotes

• Connections to mitochondrial quality control:

  • AIM31 research may reveal links between inheritance mechanisms and mitochondrial quality control systems

  • Understanding how damaged mitochondria are segregated during cell division

  • Potential relationship with mitophagy and other mitochondrial turnover pathways

• Mechanistic insights into inheritance regulation:

  • Role of AIM31 in organizing respiratory complexes may influence mitochondrial segregation

  • Potential involvement in mitochondrial membrane dynamics during division

  • Possible coordination with cytoskeletal elements that facilitate mitochondrial movement

• Relevance to programmed cell death pathways:

  • Connection between mitochondrial inheritance and susceptibility to PCD

  • Potential role in maintaining mitochondrial integrity during stress

  • Linkage between respiratory capacity and cell death decisions

Researchers investigating these aspects should employ complementary approaches including high-resolution microscopy, genetic interaction screening, and comparative genomics to place AIM31 function in the broader context of mitochondrial biology across fungal species.

How can researchers effectively address contradictory findings regarding AIM31 function across different experimental systems?

When facing contradictory findings regarding AIM31 function, researchers should implement these strategies:

• Standardization of experimental conditions:

  • Establish consistent growth media, temperature, and aeration conditions

  • Standardize genetic backgrounds used for manipulations

  • Create detailed protocols for mitochondrial isolation and analysis

• Cross-validation approaches:

  • Employ multiple independent techniques to assess the same function

  • Replicate key experiments in different laboratories

  • Validate findings across different strain backgrounds

• Systematic analysis of variables:

  • Test the impact of growth phase (exponential vs. stationary)

  • Examine effects of different carbon sources systematically

  • Evaluate oxygen concentration as a critical variable

• Integration of data across species:

  • Compare parallel experiments in S. stipitis and S. cerevisiae

  • Consider evolutionary distance when interpreting functional differences

  • Look for conserved versus divergent phenotypes

• Statistical and methodological rigor:

  • Implement appropriate statistical analyses with sufficient replication

  • Report all experimental parameters comprehensively

  • Consider power analysis when designing experiments

Researchers should be particularly attentive to differences in mitochondrial behavior between exponential and stationary growth phases, as these can significantly impact findings related to mitochondrial function . Additionally, the distinct respiratory metabolism of S. stipitis compared to Crabtree-positive yeasts may lead to apparently contradictory results when standard protocols optimized for S. cerevisiae are applied without adaptation .

What emerging technologies and approaches will advance our understanding of AIM31 function in the next decade?

Emerging technologies that will likely advance AIM31 research include:

• Advanced imaging technologies:

  • Cryo-electron tomography to visualize AIM31 in the native mitochondrial environment

  • Super-resolution live-cell imaging to track AIM31 dynamics in real-time

  • Correlative light and electron microscopy (CLEM) to combine functional and structural insights

  • Single-molecule tracking to analyze AIM31 movement within mitochondrial membranes

• Genome editing advancements:

  • More efficient CRISPR-Cas9 systems optimized for yeast species

  • Base editing and prime editing for precise genetic modifications without double-strand breaks

  • Multiplexed genetic perturbations to analyze genetic interactions systematically

• Single-cell approaches:

  • Single-cell transcriptomics to reveal cell-to-cell variability in AIM31 expression

  • Single-cell proteomics to assess protein level heterogeneity

  • Microfluidic systems to track individual cells across generations

• Structural biology methods:

  • AlphaFold and other AI-based structure prediction to model AIM31 structure

  • Hydrogen-deuterium exchange mass spectrometry to map protein interactions

  • Integrative structural biology combining multiple data types

• Systems biology integration:

  • Multi-omics data integration to build comprehensive models of AIM31 function

  • Constraint-based modeling of mitochondrial metabolism incorporating AIM31

  • Network analysis tools to position AIM31 in broader cellular contexts

These technologies will allow researchers to move beyond correlative observations to establish causal mechanisms, providing a more comprehensive understanding of how AIM31 contributes to mitochondrial function and inheritance in various yeast species under different environmental conditions.

What is the recommended protocol for purifying active recombinant AIM31 protein for functional studies?

The following protocol is recommended for purifying active recombinant AIM31:

Materials Required:

• pET vector containing His-tagged S. stipitis AIM31 sequence

• E. coli BL21(DE3) or Rosetta(DE3) cells

• LB medium with appropriate antibiotics

• IPTG

• Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 0.1% Triton X-100

• Wash buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole

• Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

• Storage buffer: PBS pH 8.0 with 6% trehalose

• Ni-NTA agarose resin

Procedure:

• Expression:

  • Transform expression plasmid into E. coli strain

  • Grow transformed cells in LB medium at 37°C to OD600 of 0.6-0.8

  • Induce protein expression with 0.5 mM IPTG

  • Continue growth at 25°C for 5-6 hours

  • Harvest cells by centrifugation at 4,000 × g for 20 minutes at 4°C

• Cell Lysis:

  • Resuspend cell pellet in lysis buffer (10 mL per gram of wet cell weight)

  • Lyse cells by sonication or mechanical disruption

  • Clarify lysate by centrifugation at 15,000 × g for 30 minutes at 4°C

• Purification:

  • Equilibrate Ni-NTA resin with lysis buffer

  • Incubate clarified lysate with resin for 1 hour at 4°C with gentle agitation

  • Pack resin into a column and collect flow-through

  • Wash column with 10 column volumes of wash buffer

  • Elute protein with 5 column volumes of elution buffer

  • Collect 1 mL fractions and analyze by SDS-PAGE

• Buffer Exchange and Storage:

  • Pool fractions containing AIM31 protein

  • Dialyze against storage buffer or use desalting columns

  • Concentrate protein if necessary using centrifugal filters

  • Aliquot and flash-freeze in liquid nitrogen

  • Store at -80°C for long-term storage

Quality Control:

• Verify protein purity by SDS-PAGE (should be >90%)

• Confirm identity by Western blot using anti-His antibodies

• Assess protein folding by circular dichroism spectroscopy

• Test activity in relevant functional assays before use in experiments

This protocol typically yields 5-10 mg of purified protein per liter of bacterial culture, with specific adaptations possibly needed based on individual laboratory equipment and specific experimental requirements.

What methods are most reliable for assessing the impact of AIM31 on mitochondrial function in yeast cells?

For reliable assessment of AIM31's impact on mitochondrial function, researchers should implement this comprehensive approach:

1. Respiratory capacity measurement:

Materials required:

• Oxygen electrode or plate reader with oxygen-sensing capability

• Appropriate buffer (typically 0.1 M potassium phosphate, pH 7.4)

• Respiratory substrates (NADH, succinate, etc.)

• Inhibitors (antimycin A, oligomycin, etc.)

Procedure:

• Isolate mitochondria from wild-type and AIM31 mutant strains

• Measure oxygen consumption rates with different substrates

• Calculate respiratory control ratio (state 3/state 4 respiration)

• Assess response to inhibitors of specific respiratory complexes

2. Mitochondrial membrane potential analysis:

Materials required:

• Fluorescent dyes (JC-1, TMRM, or Rhodamine 123)

• Fluorescence microscope or flow cytometer

• Uncoupling agents (FCCP or CCCP) as controls

Procedure:

• Incubate cells or isolated mitochondria with appropriate dye

• Measure fluorescence using microscopy or flow cytometry

• Compare membrane potential between wild-type and AIM31 mutants

• Validate with uncoupling agent controls

3. ROS production measurement:

Materials required:

• ROS-sensitive dyes (CM-H₂DCFDA, MitoSOX Red)

• Fluorescence microplate reader or flow cytometer

• Positive controls (hydrogen peroxide or menadione)

Procedure:

• Load cells with appropriate ROS-sensitive dye

• Measure fluorescence at baseline and under stress conditions

• Compare ROS production levels between strains

• Normalize to mitochondrial mass if comparing different strains

4. Mitochondrial morphology assessment:

Materials required:

• Mitochondria-targeted fluorescent proteins or dyes

• Confocal microscope with high-resolution capabilities

• Image analysis software

Procedure:

• Transform cells with mitochondria-targeted fluorescent proteins or stain with mitochondrial dyes

• Acquire z-stack images using confocal microscopy

• Quantify morphological parameters (length, branching, fragmentation)

• Compare morphological differences between wild-type and mutant strains

5. Mitochondrial protein import assay:

Materials required:

• Radiolabeled or fluorescently labeled mitochondrial precursor proteins

• Isolated mitochondria from different strains

• SDS-PAGE equipment and autoradiography/fluorescence detection

Procedure:

• Incubate isolated mitochondria with labeled precursor proteins

• Stop reaction at different time points

• Analyze protein import efficiency by gel electrophoresis

• Compare import rates between wild-type and AIM31 mutants

These methods should be performed under both standard growth conditions and stress conditions (such as oxidative stress or nutrient limitation) to comprehensively assess AIM31's role in mitochondrial function across different physiological states .

What are the critical controls and experimental design considerations for studying AIM31 in programmed cell death pathways?

When investigating AIM31's role in programmed cell death (PCD) pathways, researchers should implement these critical controls and design considerations:

Essential Controls:

• Strain validation controls:

  • Confirm AIM31 deletion/mutation by PCR and sequencing

  • Verify protein expression levels in complementation strains

  • Include isogenic wild-type strain in all experiments

• Cell death pathway controls:

  • Positive controls: Known PCD inducers (acetic acid, hydrogen peroxide)

  • Negative controls: PCD inhibitors (cycloheximide for protein synthesis-dependent PCD)

  • Parallel assessment with strains lacking key PCD components

• Mitochondrial function controls:

  • Respiratory-deficient strains (rho0 or complex deletion mutants)

  • Strains with altered mitochondrial dynamics (fission/fusion mutants)

  • Non-mitochondrial death pathway controls

Experimental Design Considerations:

• PCD induction protocols:

  • Use standardized conditions for PCD induction (140 mM acetic acid for stationary phase cells)

  • Establish dose-response curves for each inducing agent

  • Consider growth phase effects (exponential vs. stationary cells show different sensitivities)

• Multi-parameter PCD assessment:

  • Combine viability assays (colony forming units, vital dyes)

  • Assess apoptotic markers (TUNEL for DNA fragmentation)

  • Measure mitochondrial parameters (cytochrome c release, membrane potential)

• Temporal resolution:

  • Perform time-course experiments to capture the sequence of events

  • Include early time points to detect initial mitochondrial changes

  • Monitor long-term consequences to distinguish between different death modes

• Genetic interaction analysis:

  • Create double mutants with known PCD regulators

  • Test epistatic relationships to place AIM31 in pathways

  • Include cross-species complementation experiments

• Physiologically relevant conditions:

  • Test multiple PCD inducers with different mechanisms

  • Consider S. stipitis-specific metabolism when designing experiments

  • Include conditions relevant to natural yeast environments

The study of PCD in yeast should account for the heterogeneity in cell populations. Flow cytometry approaches can distinguish subpopulations with different ROS levels or mitochondrial states . Additionally, researchers should be aware that stationary phase cells typically require higher concentrations of PCD inducers compared to exponential phase cells, with 140 mM acetic acid being appropriate for stationary S. cerevisiae cells . Similar optimization should be performed for S. stipitis.

What are the most common challenges in expressing and purifying functional recombinant AIM31, and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant AIM31. Here are the most frequent issues and their solutions:

Challenge 1: Low expression levels

Solutions:

• Optimize codon usage for the expression host

• Test multiple expression strains (BL21, Rosetta, Arctic Express)

• Evaluate different expression vectors with varying promoter strengths

• Reduce expression temperature to 16-18°C and extend induction time

• Consider fusion partners that enhance expression (MBP, SUMO, Trx)

Challenge 2: Protein insolubility/inclusion body formation

Solutions:

• Decrease induction temperature to 16-20°C

• Reduce IPTG concentration to 0.1-0.2 mM

• Add solubility enhancers to growth media (sorbitol, betaine)

• Include mild detergents in lysis buffer (0.1-0.5% Triton X-100)

• Consider expressing truncated constructs excluding transmembrane regions

• Use specialized strains designed for membrane protein expression

Challenge 3: Protein instability during purification

Solutions:

• Include protease inhibitors in all buffers

• Maintain constant cold temperature throughout purification

• Add stabilizing agents (glycerol, trehalose) to all buffers

• Minimize purification steps and handling time

• Consider on-column refolding protocols if using denaturing conditions

• Test different buffer compositions for optimal stability

Challenge 4: Low protein activity after purification

Solutions:

• Verify protein folding using circular dichroism

• Test different refolding protocols if purified from inclusion bodies

• Ensure proper cofactor addition if required

• Validate with activity assays immediately after purification

• Compare activity of different construct designs (tag position, linker length)

• Screen buffer conditions for optimal activity maintenance

Challenge 5: Batch-to-batch variability

Solutions:

• Standardize growth conditions (media preparation, culture density)

• Document detailed protocols with specific equipment settings

• Implement quality control checkpoints throughout purification

• Establish activity benchmarks for acceptable preparations

• Consider automated purification systems for consistency

Researchers should also note that the storage buffer recommendation of Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been optimized for stability. For long-term storage, adding glycerol to 50% final concentration and storing at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles is highly recommended .

How can researchers overcome difficulties in creating and validating AIM31 knockout strains in S. stipitis?

Creating and validating AIM31 knockout strains in S. stipitis presents several challenges. Here are effective strategies to address them:

Challenge 1: Low transformation efficiency

Solutions:

• Optimize electroporation parameters specifically for S. stipitis

• Use lithium acetate transformation with extended incubation times

• Prepare highly competent cells by harvesting at early-mid log phase

• Include carrier DNA (salmon sperm DNA) in transformation mix

• Consider specialized transformation protocols developed for non-conventional yeasts

Challenge 2: Inefficient homologous recombination

Solutions:

• Design longer homology arms (800-1000 bp) than typically used for S. cerevisiae

• Consider transient suppression of non-homologous end joining

• Use PCR-generated deletion cassettes with extended homology regions

• Implement CRISPR-Cas9 system optimized for S. stipitis

• Screen larger numbers of transformants to identify successful integrations

Challenge 3: Difficulty confirming knockout at genomic level

Solutions:

• Design multiple PCR primer sets for verification

  • Primers outside the integration region

  • Primers spanning the junction between genome and selection marker

  • Internal primers for the deleted region (negative control)

• Perform Southern blot analysis for definitive confirmation

• Use quantitative PCR to ensure complete absence of the gene

• Sequence across the integration junctions to confirm precise replacement

Challenge 4: Phenotypic validation challenges

Solutions:

• Confirm absence of protein expression by Western blot

• Create complemented strains by reintroducing AIM31 under native promoter

• Test phenotypes under multiple growth conditions

• Compare with phenotypes of related genes or homologs from other species

• Use genome-wide approaches (transcriptomics, proteomics) to confirm expected molecular signatures

Challenge 5: Potential essentiality of AIM31

Solutions:

• Attempt to create heterozygous knockouts first

• Use regulatable promoter systems for conditional expression

• Create temperature-sensitive alleles if direct knockout is lethal

• Utilize degron systems for inducible protein depletion

• Target non-essential domains through truncations rather than complete deletion

When working with S. stipitis, researchers should be aware that standard protocols developed for S. cerevisiae often require significant modification. The unique respiratory metabolism of S. stipitis may also make certain phenotypes more pronounced or different from those observed in other yeast species, requiring careful experimental design and interpretation.

What strategies help researchers address inconsistent results when studying AIM31's impact on mitochondrial inheritance and function?

When faced with inconsistent results in AIM31 research, implement these systematic troubleshooting strategies:

1. Standardize experimental conditions:

• Growth standardization:

  • Use precisely defined media compositions

  • Maintain consistent culture densities across experiments

  • Standardize growth phase for harvesting (mid-log vs. stationary)

  • Control oxygen availability through consistent culture volumes and flask types

• Environmental control:

  • Maintain strict temperature regulation during experiments

  • Document and control pH of media

  • Standardize light exposure for photosensitive experiments

  • Use temperature and CO2-controlled incubators for consistent growth

2. Implement robust experimental design:

• Controls and replication:

  • Include multiple biological replicates (different colonies/transformants)

  • Perform technical replicates to assess method variability

  • Use internal controls within each experiment

  • Include isogenic wild-type controls in every experiment

• Blind analysis:

  • Code samples to prevent observer bias

  • Automate quantification where possible

  • Have multiple researchers independently assess critical phenotypes

  • Implement computational image analysis for morphological studies

3. Optimize assay conditions for S. stipitis:

• Mitochondrial isolation:

  • Adapt protocols specifically for S. stipitis cell wall composition

  • Optimize spheroplasting conditions for efficient cell lysis

  • Use density gradient purification for mitochondrial preparation

  • Validate mitochondrial integrity before functional assays

• Functional assays:

  • Calibrate respiration measurements to account for high basal respiratory capacity

  • Adjust ROS detection methods for S. stipitis' antioxidant capacity

  • Optimize staining protocols for S. stipitis' membrane composition

  • Develop specific activity assays relevant to AIM31's predicted function

4. Address biological heterogeneity:

• Clone variation:

  • Maintain careful records of strain lineages

  • Use multiple independent clones for key experiments

  • Back-cross strains to reduce accumulated secondary mutations

  • Sequence verify strains periodically to confirm genetic stability

• Population analysis:

  • Use flow cytometry to assess cell-to-cell variation

  • Employ single-cell analysis where appropriate

  • Consider cell sorting to isolate uniform populations

  • Account for different cell cycle stages in data interpretation

5. Validation across systems:

• Cross-platform validation:

  • Verify key findings using independent methodological approaches

  • Confirm results using both in vivo and in vitro systems

  • Validate with multiple different assays measuring the same parameter

  • Test in different genetic backgrounds to ensure robustness

Research on mitochondrial function is particularly sensitive to metabolic state and growth conditions. The distinct respiratory metabolism of S. stipitis compared to model yeasts like S. cerevisiae necessitates careful adaptation of protocols and interpretation frameworks to obtain consistent results.