Recombinant Scheffersomyces stipitis Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; PICST_29392; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Target Names
GET1
Target Protein Sequence
MGILAALDLHPYTLVVSSFTVLLIQQLVGFIGKSTIQEFAWLFYLRVGGKLGLSNSFVAH TKKQEELHKLNREKRSISAQDEYAKWTKLNRQAEKLTAEVKSLSDDIAKDKSKINSLVGV VLLFLTTLPLWVFRLWFRKSVLFYLPTGVFPYYVERVLAIPFFASGSVGLTVWMFAVNNV ISSVLFLLTFPFKPSVPIPIRQTKVEEVVPESAESKESSPEVIDIADAN
Uniprot No.

Target Background

Function

Recombinant Scheffersomyces stipitis Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins possessing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does S. stipitis genome plasticity potentially impact GET1 expression?

The remarkable genome plasticity of S. stipitis, characterized by chromosome rearrangements and retrotransposon activity, likely influences GET1 expression and function . Different S. stipitis isolates show distinct chromosome organizations, and extensive genomic changes are detected following in vitro evolution experiments . This genomic fluidity could affect GET1 expression levels or patterns in several ways:

  • Transposable element insertions near the GET1 locus might alter its regulatory regions

  • Chromosomal rearrangements could place GET1 in different genomic neighborhoods, affecting its access to transcriptional machinery

  • Copy number variations might occur during adaptation events

To investigate these effects, comparative genomic approaches using Hybrid MinION Nanopore and Illumina sequencing can be employed to track GET1 locus changes across different isolates and growth conditions .

What expression systems are recommended for producing recombinant S. stipitis GET1?

For recombinant expression of S. stipitis GET1, several experimental approaches can be considered:

  • Homologous expression in S. stipitis itself, which maintains native codon usage and post-translational modification machinery

  • Heterologous expression in S. cerevisiae, which offers extensive genetic tools while maintaining relatively similar cellular machinery

  • Expression in bacterial systems for structural studies, though this may require codon optimization and lacks post-translational modifications

For membrane proteins like GET1, expression systems that employ weak to moderate constitutive promoters often yield better results than strong inducible promoters, as overexpression can overwhelm membrane insertion machinery and lead to protein aggregation. When cultivating S. stipitis for protein expression, researchers typically use synthetic complete media with appropriate carbon sources like glucose or xylose (SC-G or SC-X), with growth at 30°C being standard .

What sequence conservation exists between S. stipitis GET1 and homologs in other yeasts?

While specific sequence analysis of S. stipitis GET1 is not explicitly detailed in the current literature, proteins involved in fundamental cellular processes like ER-Golgi trafficking typically show significant conservation across the CTG(Ser1) clade. Comparative genomic approaches can be used to assess GET1 conservation between S. stipitis and other yeasts like C. albicans or S. cerevisiae. Key conserved regions likely include transmembrane domains and interaction interfaces with trafficking machinery components.

For a comprehensive analysis, researchers should perform multiple sequence alignments followed by calculation of conservation scores for each amino acid position. Hydrophobicity plots are particularly useful for membrane proteins like GET1 to identify transmembrane domains that are often highly conserved.

How might retrotransposon activity in S. stipitis affect GET1 function during adaptation to different carbon sources?

S. stipitis genome sequencing has identified retrotransposons as major drivers of genome diversity . These mobile genetic elements differ in number and position between different S. stipitis isolates and are frequently found at sites of chromosome rearrangements . When S. stipitis adapts to challenging carbon sources like xylose, genomic reshuffling mediated by these retrotransposons could potentially affect GET1 in several ways:

  • Direct disruption of the GET1 coding sequence

  • Alterations in regulatory regions controlling GET1 expression

  • Changes in chromatin structure affecting accessibility of the GET1 locus

  • Creation of novel gene fusions involving GET1

Experimental approaches to study this relationship should include:

Experimental ApproachPurposeExpected Outcome
Long-read sequencing of evolved strainsIdentify structural variantsMap retrotransposon insertions relative to GET1
RNA-seq of adapted strainsMeasure GET1 expression changesCorrelate expression with genomic rearrangements
ChIP-seq for chromatin marksAssess regulatory changesIdentify epigenetic changes at GET1 locus
CRISPR interference at retrotransposon sitesTest causalityDetermine if specific elements affect GET1 function

These approaches would help determine whether retrotransposon-mediated genome plasticity directly impacts protein trafficking pathways during adaptation processes .

What methodologies are most effective for studying GET1 localization in S. stipitis?

Studying membrane protein localization in S. stipitis requires specialized approaches:

  • Fluorescent protein tagging: C-terminal or internal tagging of GET1 with mNeonGreen or mScarlet provides optimal brightness with minimal functional disruption. N-terminal tagging should be avoided as it likely interferes with membrane insertion signals.

  • Sample preparation: For fixed cell microscopy, brief fixation (10-15 minutes) with 3.7% formaldehyde preserves membrane structures while allowing antibody penetration if immunofluorescence is needed.

  • Microscopy techniques:

    • Confocal microscopy for co-localization with ER/Golgi markers

    • Super-resolution techniques (STED, PALM) for detailed membrane organization

    • Live-cell imaging to track trafficking dynamics

  • Controls and validation:

    • Co-staining with established organelle markers (e.g., Sec61 for ER)

    • Functional assays to ensure tagged proteins retain activity

    • Electron microscopy for ultrastructural validation

When analyzing results, quantitative co-localization analysis using Pearson's or Manders' coefficients should be performed to assess the degree of overlap between GET1 and organelle markers.

How does chromosome reorganization in S. stipitis affect the expression of protein trafficking genes like GET1?

S. stipitis exhibits remarkable chromosome plasticity, with different isolates showing distinct chromosome organizations . This genomic flexibility likely impacts gene expression patterns, including those involved in protein trafficking. During adaptation to challenging environments, extensive genomic changes with fitness benefits have been detected .

To investigate how chromosome reorganization affects GET1 and other trafficking genes:

  • Perform Hi-C or chromosome conformation capture to map the 3D organization of the genome in different isolates and conditions

  • Correlate transcriptome data with chromosome structure to identify position effects

  • Use CUT&RUN or similar techniques to map regulatory protein binding at the GET1 locus across different genomic arrangements

  • Employ CRISPR-Cas9 to engineer specific chromosomal rearrangements and assess their impact on GET1 expression

Researchers have shown that the translocation breakpoints between chromosomes in S. stipitis are enriched in retrotransposons , suggesting that these mobile elements may drive reorganization events that subsequently affect gene expression patterns of membrane trafficking components.

What are the best experimental designs for studying GET1 function during S. stipitis adaptation to different carbon sources?

Given S. stipitis' importance in biofuel production and its ability to ferment xylose , studying how GET1 functions during carbon source adaptation requires carefully designed experiments:

  • Continuous evolution approach:

    • Establish chemostat cultures with gradual transition from glucose to xylose

    • Sample at regular intervals (every 10-15 generations)

    • Perform whole genome sequencing to track GET1 locus changes

    • Measure GET1 expression via RT-qPCR or RNA-seq

    • Analyze protein trafficking efficiency using reporter assays

  • Comparative analysis:

    • Generate GET1 knockout strains

    • Compare growth rates on different carbon sources (glucose, xylose, mixed sugars)

    • Perform transcriptome and proteome analysis to identify compensatory changes

    • Analyze secretome changes to detect protein trafficking defects

For in vitro evolution analyses, researchers typically use synthetic complete media containing glucose (SC-G), xylose (SC-X), or a mixture of 60% glucose and 40% xylose (SC-G+X) to mimic lignocellulosic composition . Growth conditions should be standardized at 30°C with appropriate supplements and proper experimental controls.

How can CRISPR-Cas9 be optimized for editing the GET1 locus in S. stipitis?

Developing effective CRISPR-Cas9 protocols for S. stipitis requires consideration of its unique genomic features:

  • Guide RNA design considerations:

    • Account for the alternative genetic code in CTG(Ser1) clade yeasts

    • Target regions away from retrotransposon-rich areas to avoid off-target effects

    • Use algorithms that consider S. stipitis-specific sequence context

  • Delivery method optimization:

    • Lithium acetate transformation with single-stranded DNA donors for point mutations

    • Electroporation for higher efficiency when making larger modifications

    • Viral vectors for difficult-to-transform strains

  • Selection strategies:

    • Employ split-marker approaches with auxotrophic markers

    • Consider transient expression systems to minimize genomic integration of Cas9

    • Use inducible promoters to control Cas9 expression timing

  • Verification protocols:

    • Combine PCR verification with sequencing

    • Check for unintended chromosomal rearrangements using karyotype analysis

    • Verify GET1 protein expression and localization after editing

The genome plasticity of S. stipitis may affect editing efficiency and outcomes, requiring careful validation of edits and assessment of genetic stability in edited strains.

What protein purification strategies work best for recombinant S. stipitis GET1?

Purifying membrane proteins like GET1 from S. stipitis requires specialized approaches:

  • Membrane preparation:

    • Mechanical disruption (glass beads) at 4°C in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (10,000×g to remove cell debris, followed by 100,000×g to pellet membranes)

    • Washing steps to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Test solubilization conditions (temperature, time, detergent:protein ratio)

    • Consider native nanodiscs or SMALPs for maintaining native lipid environment

  • Chromatography strategy:

    • Initial IMAC purification if His-tagged

    • Size exclusion chromatography to remove aggregates

    • Ion exchange as a polishing step

  • Quality assessment:

    • SDS-PAGE and western blotting

    • Circular dichroism to verify secondary structure

    • Thermostability assays to assess protein folding

When designing expression constructs, using a C-terminal purification tag is generally preferable for membrane proteins to avoid interfering with N-terminal targeting sequences. A TEV cleavage site between the protein and tag allows for tag removal if needed for downstream applications.

How can researchers differentiate between genomic plasticity effects and direct GET1 functions in S. stipitis?

S. stipitis genomic plasticity creates unique challenges when studying specific gene functions . To distinguish between phenotypes caused by genomic reorganization versus direct GET1 functions:

  • Use multiple independent knockout or mutant strains to control for background effects

  • Perform complementation studies with GET1 expressed from different genomic locations

  • Employ inducible systems that allow rapid GET1 depletion to capture immediate effects

  • Create GET1 variants with specific function-disrupting mutations rather than complete knockouts

For experimental validation, design a matrix approach:

Strain TypeControl ConditionTest ConditionWhat This Tests
Wild-typeGlucoseXyloseBaseline adaptation
GET1 knockoutGlucoseXyloseComplete function loss
GET1 point mutantGlucoseXyloseSpecific function disruption
GET1 complementedGlucoseXyloseRescue of function
GET1 overexpressionGlucoseXyloseFunction enhancement

Analysis should include genome sequencing of each strain to account for any background genomic changes that might occur during strain construction, especially given S. stipitis' genome plasticity .

What are the most reliable reference genes for qPCR studies of GET1 expression in S. stipitis?

When studying GET1 expression in S. stipitis using qPCR, selecting appropriate reference genes is critical due to the organism's genomic plasticity and adaptability to different carbon sources :

  • Stability analysis approach:

    • Test candidate reference genes across all experimental conditions

    • Apply multiple algorithms (geNorm, NormFinder, BestKeeper) to assess stability

    • Select at least three reference genes for normalization

  • Recommended candidates based on studies in related yeasts:

    • ACT1 (actin) - structural protein with relatively stable expression

    • TDH3 (glyceraldehyde-3-phosphate dehydrogenase) - central metabolic enzyme

    • ALG9 (mannosyltransferase) - involved in N-glycosylation

    • TAF10 (transcription factor) - basic transcription machinery component

  • Validation protocol:

    • Perform efficiency tests using standard curves

    • Verify single PCR products via melt curve analysis

    • Calculate stability values across experimental conditions

  • qPCR experimental design:

    • Include no-template and no-RT controls

    • Run technical triplicates and biological replicates

    • Use inter-run calibrators if multiple plates are required

When analyzing GET1 expression during adaptation experiments, researchers should be particularly careful to validate reference gene stability, as genome reorganization events may affect traditional housekeeping genes .

How can researchers design evolution experiments to study GET1 adaptation in S. stipitis?

S. stipitis shows rapid genomic adaptation to environmental changes, making it ideal for studying protein evolution . To design evolution experiments focused on GET1:

  • Selection pressure strategies:

    • Gradually increase stress levels that might affect protein trafficking (e.g., ER stress inducers)

    • Alternate between carbon sources requiring different metabolic adaptations

    • Introduce chemical inhibitors targeting GET1-related pathways

  • Experimental setup:

    • Use continuous culture systems (chemostats) to maintain constant selection pressure

    • Implement serial batch transfers with increasing stress at each transfer

    • Consider adaptive laboratory evolution with automated systems for long-term studies

  • Sampling approach:

    • Collect samples at regular intervals (e.g., every 50 generations)

    • Freeze stocks of evolved populations and single clones

    • Extract DNA, RNA, and protein from the same samples for integrated analysis

  • Analysis pipeline:

    • Whole genome sequencing to identify mutations in GET1 and related genes

    • RNA-seq to measure expression changes

    • Proteomics to assess protein levels and modifications

    • Functional assays to test protein trafficking efficiency

For S. stipitis, in vitro evolution analyses should be conducted using appropriate media such as synthetic complete media with glucose (SC-G), xylose (SC-X), or mixed sugars (SC-G+X) . CHEF electrophoresis can be used to monitor chromosomal rearrangements during evolution .

What structural biology techniques are most appropriate for studying S. stipitis GET1?

Membrane proteins like GET1 present unique challenges for structural determination:

  • Cryo-electron microscopy (cryo-EM):

    • Most suitable for membrane proteins like GET1

    • Can resolve structures in near-native environments

    • Works with smaller sample amounts compared to crystallography

    • Sample preparation involves purification in detergent or nanodiscs followed by vitrification

  • X-ray crystallography considerations:

    • Requires extensive screening of crystallization conditions

    • Often necessitates construct engineering to remove flexible regions

    • Lipidic cubic phase crystallization may be appropriate for membrane proteins

  • NMR approaches:

    • Best for dynamic studies of specific domains rather than full-length GET1

    • Requires isotopic labeling (13C, 15N) which can be achieved in yeast

    • 2D experiments like HSQC can map interaction surfaces

  • Computational methods:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to study dynamics in membrane

    • Coevolution analysis to predict interaction interfaces

A hybrid approach combining low-resolution cryo-EM with computational modeling and targeted biochemical experiments often yields the most comprehensive structural insights for challenging membrane proteins like GET1 from non-model organisms like S. stipitis.

How can researchers address S. stipitis genome instability issues when working with GET1?

The inherent genome plasticity of S. stipitis creates unique challenges when establishing stable expression systems . To address these issues:

  • Strain stabilization strategies:

    • Generate and compare multiple independent transformants

    • Assess karyotype stability over time using CHEF electrophoresis

    • Monitor GET1 expression levels across generations

    • Consider integrating GET1 into more stable genomic regions away from retrotransposons

  • Experimental controls:

    • Sequence verify the GET1 locus before each experiment

    • Include wild-type controls propagated for the same number of generations

    • Implement regular checks of strain identity and genetic stability

  • Media and growth considerations:

    • Minimize stress conditions that might trigger genome reorganization

    • Standardize growth conditions and media compositions

    • Implement shorter cultivation periods when possible

  • Data analysis approaches:

    • Apply statistical methods that account for strain-to-strain variability

    • Consider hierarchical experimental designs that nest biological replicates

Researchers should be particularly attentive to the impact of retrotransposons, as these have been identified as major drivers of S. stipitis genome diversity and could potentially affect GET1 expression and function during laboratory cultivation.

What are the common pitfalls when interpreting GET1 localization data in S. stipitis?

Interpreting protein localization data in S. stipitis requires careful consideration of several factors:

  • Technical artifacts:

    • Fixation can alter membrane morphology and protein distribution

    • Overexpression can lead to mislocalization and aggregation

    • Fluorescent tags may interfere with trafficking signals

  • Biological considerations:

    • S. stipitis may have different organelle morphology compared to model yeasts

    • Genome plasticity may affect endomembrane organization

    • Carbon source can influence organelle structure and distribution

  • Control experiments required:

    • Co-localization with multiple organelle markers

    • Functional complementation to verify tagged protein activity

    • Analysis across different growth phases and conditions

  • Quantitative analysis recommendations:

    • Use object-based rather than pixel-based co-localization

    • Implement unbiased automated image analysis workflows

    • Apply appropriate statistical tests for distribution comparisons

When studying GET1, which cycles between organelles, snapshot imaging may capture different stages of trafficking. Time-lapse imaging or pulse-chase approaches provide more complete understanding of dynamic localization patterns.

How can researchers accurately measure protein trafficking defects in S. stipitis GET1 mutants?

Measuring protein trafficking defects requires sensitive and specific assays:

  • Reporter protein approaches:

    • Use secreted enzymes (invertase, acid phosphatase) to assess secretory pathway function

    • Employ ER-retained GFP variants to measure retrieval efficiency

    • Utilize split fluorescent proteins to detect specific compartment delivery

  • Biochemical fractionation methods:

    • Implement differential centrifugation to isolate organelles

    • Use density gradient separation for finer resolution of compartments

    • Apply protease protection assays to determine membrane topology

  • Microscopy-based trafficking assays:

    • Photoactivatable or photoconvertible fluorescent proteins for pulse-chase visualization

    • RUSH (Retention Using Selective Hooks) system for synchronized cargo release

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Data analysis approaches:

    • Quantify trafficking kinetics rather than just endpoint measurements

    • Implement Bayesian statistical models to handle biological variability

    • Develop computational models that integrate multiple trafficking parameters

These approaches should be calibrated using known trafficking mutants and validated across multiple experimental conditions, particularly considering S. stipitis' adaptation capabilities and genomic plasticity .

What controls are essential when performing GET1 knockout studies in S. stipitis?

Given S. stipitis' genome plasticity , rigorous controls are essential when performing gene knockout studies:

  • Genetic verification:

    • Confirm deletion by both PCR and sequencing

    • Verify absence of GET1 expression by RT-PCR and western blotting

    • Check for unintended genomic rearrangements using karyotype analysis

  • Phenotypic controls:

    • Generate multiple independent knockout clones

    • Create revertant strains by reintroducing GET1 at its native locus

    • Test complementation with GET1 from related species

  • Experimental design considerations:

    • Include isogenic wild-type controls propagated under identical conditions

    • Monitor strain stability throughout experiments

    • Test phenotypes under multiple growth conditions

  • Potential confounding factors:

    • Compensatory adaptations may occur rapidly due to genome plasticity

    • Expression of related genes may change to compensate for GET1 loss

    • Growth conditions may influence the severity of knockout phenotypes

Researchers should implement a multifaceted approach to phenotypic analysis, combining growth assays, microscopy, and biochemical measurements to comprehensively characterize GET1 function in S. stipitis.

How can researchers distinguish between primary and secondary effects of GET1 manipulation in S. stipitis?

Distinguishing direct effects from adaptive responses is particularly challenging in S. stipitis due to its genomic plasticity :

  • Temporal analysis approaches:

    • Use inducible or repressible promoters to control GET1 expression

    • Perform time-course experiments capturing immediate vs. delayed responses

    • Implement rapid protein degradation systems (AID, dTAG) for acute depletion

  • Genetic interaction mapping:

    • Perform epistasis analysis with known trafficking pathway components

    • Create double mutants to identify synthetic interactions

    • Use genome-wide screens to map genetic interaction networks

  • Molecular approaches:

    • Identify direct GET1 interaction partners using proximity labeling (BioID, APEX)

    • Map the immediate transcriptional response to GET1 depletion

    • Use metabolomics to identify rapid metabolic shifts following GET1 manipulation

  • Computational integration:

    • Develop predictive models incorporating known protein trafficking pathways

    • Use network analysis to distinguish primary hubs from secondary effects

    • Implement machine learning approaches to classify direct vs. indirect phenotypes

These strategies should be implemented with careful consideration of S. stipitis' capacity for rapid genomic adaptation , which may confound the interpretation of experimental results if not properly controlled.

How might S. stipitis GET1 function be leveraged for improving biofuel production?

S. stipitis has enormous potential for second-generation biofuel production , and understanding GET1's role in protein trafficking might contribute to strain improvement:

  • Engineering opportunities:

    • Optimize secretion pathways for enhanced enzyme export

    • Improve stress tolerance through modified membrane protein trafficking

    • Engineer carbon source sensing and signaling pathways

  • Research priorities:

    • Characterize GET1's role in adapting to lignocellulosic hydrolysates

    • Investigate protein trafficking changes during xylose fermentation

    • Map GET1 interactions with stress response pathways

  • Biotechnological applications:

    • Develop GET1 variants with enhanced trafficking properties

    • Create biosensors based on protein trafficking responses

    • Implement genomic stabilization strategies for industrial strains

  • Integration with systems biology:

    • Model protein trafficking networks in relation to metabolic fluxes

    • Identify trafficking bottlenecks during biofuel production

    • Apply genome-scale models to predict GET1-related engineering targets

Understanding how S. stipitis' genomic plasticity affects protein trafficking during adaptation to different feedstocks could provide key insights for developing more robust and efficient biofuel production strains.

What emerging technologies will advance our understanding of S. stipitis GET1?

Several cutting-edge technologies show promise for deepening our understanding of protein trafficking in S. stipitis:

  • Advanced imaging techniques:

    • Lattice light-sheet microscopy for long-term live imaging with minimal phototoxicity

    • Correlative light and electron microscopy (CLEM) for combining dynamic and ultrastructural data

    • Super-resolution techniques adapted for yeast cells

  • Functional genomics approaches:

    • CRISPR interference/activation for tunable gene expression

    • Base editing for precise mutation introduction

    • Perturb-seq for high-throughput phenotyping of genetic variants

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in GET1 expression

    • Single-cell proteomics to measure protein trafficking dynamics

    • Microfluidic systems for tracking adaptation at the single-cell level

  • Computational advances:

    • Deep learning for image analysis and phenotype classification

    • Molecular dynamics simulations of membrane protein trafficking

    • Multi-scale modeling integrating genomic, transcriptomic, and proteomic data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.