Recombinant Scheffersomyces stipitis Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and agreed upon in advance. Dry ice shipping incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET2; PICST_81524; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Target Names
GET2
Target Protein Sequence
MSDSPSISAEERKRILRERRAAKMAKGNATSRLNTILTQGNSVKDVSSVKSVLDQEPTGA TATTTGNHDLDPDHHDIEGFINTPGINASNDSVALSNSEDIDEMFKKIFGGQVPGNGTDG AGSEDPLAQMMKMFSQPGAGTGTNTPFSEDPFSAQPEEFKYQQQLVQYNTYRHQVWKFRF LAVRYFALLANFIYHFYIIGDSISFASSSHQFIRELIPVEPARSFFTLFSTIEVVIIASY YFLGTKEGFFSTATSNNFVVKLLDMGSMVLPQLQQFKTIAVRLLGYYELLAVLLGDLSLV VVLFGLHSVLGN
Uniprot No.

Target Background

Function
Recombinant *Scheffersomyces stipitis* Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). GET2, in conjunction with GET1, functions as a membrane receptor for soluble GET3. GET3 recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.
Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Golgi to ER Traffic Protein 2 (GET2) and what is its function in Scheffersomyces stipitis?

GET2 (Golgi to ER Traffic Protein 2) is a membrane protein involved in the retrograde transport pathway from the Golgi apparatus to the endoplasmic reticulum (ER) in the yeast Scheffersomyces stipitis. The protein facilitates vesicular transport between these organelles, which is essential for maintaining proper protein homeostasis within the cell . GET2 functions as part of a complex that recognizes and facilitates the return of certain proteins from the Golgi to the ER, participating in what is known as retrograde trafficking, an essential cellular process in eukaryotic organisms including yeasts.

How should recombinant Scheffersomyces stipitis GET2 protein be stored for optimal stability?

For optimal stability of recombinant Scheffersomyces stipitis GET2 protein, the following storage conditions are recommended:

Storage ConditionRecommendationPurpose
Short-term storage4°C for up to one weekMaintains protein activity for immediate use
Long-term storage-20°C or -80°CPreserves protein integrity over extended periods
Storage bufferTris-based buffer with 50% glycerolStabilizes protein structure and prevents degradation
Freeze-thaw cyclesAvoid repeated freezing and thawingPrevents protein denaturation and loss of activity
AliquotingDivide into small working volumesMinimizes exposure to damaging conditions

Working with aliquots rather than repeatedly accessing the stock solution is strongly recommended to maintain protein integrity . When reconstituting lyophilized protein, it is advisable to centrifuge the vial briefly before opening and use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage.

What expression systems are suitable for producing recombinant Scheffersomyces stipitis GET2?

Escherichia coli is the most commonly used expression system for recombinant Scheffersomyces stipitis GET2 production, as evidenced by commercially available products . E. coli offers advantages including rapid growth, high protein yield, and well-established protocols for induction and purification. For experimental purposes, researchers should consider the following factors when selecting an expression system:

  • Protein solubility: GET2 contains hydrophobic regions that may affect solubility in bacterial systems

  • Post-translational modifications: If studying function-dependent modifications, yeast or mammalian systems might be preferable

  • Purification strategy: His-tagged versions facilitate purification using nickel affinity chromatography

  • Experimental requirements: Consider downstream applications when choosing between different tagging systems (His, GST, etc.)

While E. coli is the predominant system, alternative expression hosts might be considered depending on specific research questions, particularly if native folding or post-translational modifications are critical to the study.

What experimental approaches can be used to study GET2 trafficking dynamics in live cells?

Studying GET2 trafficking dynamics in live cells requires sophisticated imaging techniques and experimental designs. Based on approaches used for similar proteins, researchers can employ:

  • Fluorescent protein tagging: GFP-GET2 fusion proteins can be constructed to visualize trafficking in real-time using confocal microscopy, similar to methods used for other Golgi proteins . This approach allows for dynamic tracking of protein movement between organelles.

  • Temperature-sensitive mutant analysis: Temperature-shift experiments can reveal immediate effects on protein localization. As demonstrated in studies with other trafficking proteins, shifts in temperature can trigger dispersal of Golgi markers into vesicular structures within minutes in certain mutant backgrounds .

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can measure the kinetics of GET2 movement between compartments by selectively bleaching fluorescence in one area and monitoring recovery.

  • Pulse-chase experiments: Using inducible expression systems combined with fluorescent timers to distinguish newly synthesized from older protein populations.

  • Co-localization studies: Dual-color imaging with markers for different compartments (ER, Golgi, vesicles) to track the spatial distribution and movement of GET2.

These approaches should be implemented with appropriate controls and careful experimental design to account for variables that might affect trafficking dynamics .

How can researchers optimize the purification protocol for recombinant Scheffersomyces stipitis GET2?

Optimizing purification of recombinant Scheffersomyces stipitis GET2 requires addressing several critical factors:

Purification StepKey ConsiderationsOptimization Strategies
Cell lysisMembrane protein solubilizationTest multiple detergents (DDM, CHAPS, Triton X-100) at varying concentrations
Affinity chromatographyTag accessibilityUse extended linkers between protein and tag; optimize binding buffer composition
Buffer compositionProtein stabilityInclude glycerol (10-50%), reduce detergent in elution buffers
Contaminant removalPurity requirementsConsider secondary purification steps (ion exchange, size exclusion)
ConcentrationAggregation preventionUse centrifugal concentrators with appropriate MWCO; add stabilizing agents

For His-tagged GET2 variants, researchers should implement a purification workflow that begins with efficient cell lysis, followed by immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins . The membrane-associated nature of GET2 presents unique challenges, requiring careful optimization of detergent type and concentration to maintain protein solubility without denaturing the target. Purity assessment via SDS-PAGE is crucial at each purification stage, with the target of achieving >90% purity for functional studies.

What are the current methodological challenges in studying GET2-dependent trafficking pathways?

Several methodological challenges exist in studying GET2-dependent trafficking pathways:

Addressing these challenges requires implementing rigorous experimental designs with appropriate controls and validation across multiple methodological approaches.

How can researchers design experiments to elucidate the interaction network of GET2?

To effectively map the interaction network of GET2, researchers should employ a multi-method approach:

  • Proximity-based labeling: BioID or APEX2 fusion proteins can identify proteins in close proximity to GET2 in living cells. These methods involve fusing a biotin ligase or peroxidase to GET2, which then biotinylates nearby proteins that can be purified and identified by mass spectrometry.

  • Co-immunoprecipitation with mass spectrometry (Co-IP-MS): Using antibodies against tagged GET2 to pull down protein complexes, followed by proteomic analysis to identify interacting partners.

  • Yeast two-hybrid screening: Although challenging for membrane proteins, modified split-ubiquitin systems can be employed for membrane-localized GET2.

  • FRET/BRET assays: These can detect direct protein-protein interactions in living cells by measuring energy transfer between fluorophores attached to potential interacting partners.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry analysis can map specific interaction domains between GET2 and its partners.

When designing these experiments, researchers should consider:

  • Control for non-specific interactions using appropriate negative controls

  • Validate key interactions through reciprocal pull-downs and functional assays

  • Consider compartment-specific interactions by using organelle fractionation before analysis

  • Account for potential interaction dynamics by examining different cellular conditions

A well-designed experimental approach combines multiple complementary methods to build confidence in the interaction network identified.

How should researchers design quantitative experiments to measure GET2 trafficking rates?

Designing quantitative experiments to measure GET2 trafficking rates requires careful consideration of variables and appropriate controls. Following established principles of experimental design:

  • Define variables clearly:

    • Independent variable: Conditions affecting trafficking (temperature, mutations, inhibitors)

    • Dependent variable: Measurable trafficking parameters (protein localization, transport rates)

    • Control variables: Cell type, expression levels, imaging conditions

  • Implement quantitative imaging approaches:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure kinetics of protein movement

    • Single-particle tracking to follow individual vesicles containing labeled GET2

    • Pulse-chase imaging with photoconvertible fluorescent proteins to distinguish protein populations

  • Establish appropriate controls:

    • Positive controls: Proteins with well-characterized trafficking rates

    • Negative controls: Non-trafficking membrane proteins

    • System validation: Benchmark against established trafficking inhibitors

  • Analyze data with appropriate statistical methods:

    • Fit recovery curves to mathematical models for FRAP analysis

    • Apply trajectory analysis for particle tracking data

    • Implement analysis pipelines that account for cell-to-cell variability

Researchers should design experiments with sufficient replication (both technical and biological) to ensure statistical power while controlling for variables that might confound measurements .

What are the key considerations for interpreting contradictory results in GET2 functional studies?

When faced with contradictory results in GET2 functional studies, researchers should systematically evaluate several factors:

  • Expression level effects:

    • Overexpression artifacts vs. physiological expression

    • Competition with endogenous proteins

    • Potential dominant-negative effects of tagged constructs

  • Tag interference:

    • Position-dependent effects (N-terminal vs. C-terminal tags)

    • Tag size and properties affecting protein function

    • Potential disruption of interaction domains

  • Cell-type and species differences:

    • Variation in trafficking machinery between organisms

    • Cell-type specific adaptor proteins or regulatory mechanisms

    • Differences in membrane composition affecting protein function

  • Assay-specific limitations:

    • In vitro vs. in vivo conditions

    • Acute vs. chronic perturbations

    • Direct vs. indirect readouts of function

  • Protocol variations:

    • Buffer compositions affecting protein stability

    • Temperature conditions altering membrane fluidity

    • Fixation methods potentially creating artifacts in localization studies

When documenting contradictory findings, researchers should meticulously record experimental conditions and consider performing orthogonal assays to validate results. Multi-laboratory validation or the use of complementary methodological approaches can help resolve discrepancies and build consensus around GET2 function .

How can researchers effectively troubleshoot issues with recombinant GET2 solubility and activity?

Troubleshooting recombinant GET2 solubility and activity issues requires a systematic approach:

ProblemPotential CausesTroubleshooting Strategies
Poor solubilityHydrophobic transmembrane domainsTest different detergents (DDM, CHAPS, LDAO); optimize detergent:protein ratio
Improper foldingModify expression conditions (temperature, induction time); use fusion partners (MBP, SUMO)
Buffer incompatibilityScreen buffer compositions varying pH, salt concentration, and additives
Low activityDenaturation during purificationGentler purification conditions; avoid harsh elution methods
Missing cofactors or partnersSupplement with lipids or co-express with interacting proteins
Improper post-translational modificationsConsider expression in eukaryotic systems
AggregationConcentration-dependent effectsDetermine critical concentration threshold; maintain below aggregation point
Storage conditionsOptimize cryoprotectants; test flash-freezing vs. slow cooling
Buffer compositionInclude stabilizing agents (glycerol, specific lipids, osmolytes)

When activity is compromised, researchers should:

  • Verify protein integrity by SDS-PAGE and western blotting

  • Assess secondary structure using circular dichroism spectroscopy

  • Develop activity assays with positive controls to benchmark function

  • Consider lipid reconstitution approaches for membrane proteins

  • Implement thermal stability assays to identify stabilizing conditions

A methodical investigation of expression, purification, and storage conditions, combined with careful activity assessment, can resolve many common issues encountered with recombinant GET2.

How can researchers integrate GET2 studies with broader vesicular trafficking research?

Integrating GET2 studies with broader vesicular trafficking research requires connecting specific findings about this protein to larger cellular processes. Researchers can implement several approaches:

  • Comparative analysis across species:

    • Align GET2 sequences from multiple organisms to identify conserved domains

    • Compare trafficking phenotypes in different model systems

    • Use complementation studies to test functional conservation

  • System-level trafficking analysis:

    • Position GET2 within known trafficking pathways using genetic interaction mapping

    • Apply network analysis to identify functional hubs and bottlenecks

    • Investigate compensatory mechanisms when GET2 function is compromised

  • Multi-omics integration:

    • Combine proteomics data on GET2 interactors with transcriptomics under different conditions

    • Correlate GET2 function with metabolomic changes in the secretory pathway

    • Develop models that predict system-level responses to GET2 perturbation

  • Visualization of complete trafficking circuits:

    • Apply advanced imaging to track multiple components simultaneously

    • Implement pulse-chase experiments to follow cargo through complete trafficking routes

    • Develop biosensors to monitor GET2 activity in conjunction with other trafficking events

By connecting GET2-specific mechanisms to broader cellular processes, researchers can develop more comprehensive models of intracellular trafficking dynamics and identify potential regulatory nodes for therapeutic intervention.

What approaches can be used to investigate the evolutionary conservation of GET2 function across species?

Investigating the evolutionary conservation of GET2 function across species requires integrating bioinformatic and experimental approaches:

  • Sequence-based analysis:

    • Multiple sequence alignment of GET2 homologs to identify conserved domains

    • Phylogenetic analysis to map evolutionary relationships

    • Identification of co-evolving residues suggesting functional interactions

  • Structural comparison:

    • Homology modeling of GET2 across species

    • Comparison of predicted transmembrane topology

    • Analysis of conserved surface patches likely involved in protein-protein interactions

  • Functional complementation assays:

    • Expression of GET2 from different species in a model organism lacking the endogenous protein

    • Quantitative assessment of functional rescue

    • Domain swapping to identify species-specific functional regions

  • Interactome conservation:

    • Compare GET2 binding partners across species using affinity purification-mass spectrometry

    • Assess conservation of protein complex composition

    • Identify species-specific adaptors or regulators

  • Cellular localization patterns:

    • Compare GET2 distribution within cellular compartments across species

    • Analyze trafficking dynamics using fluorescently tagged proteins

    • Quantify responses to trafficking perturbations in different organisms

These approaches should be implemented with careful consideration of the specific biological questions being addressed, with appropriate controls to account for expression differences and potential artifacts from heterologous expression systems.

What are the most promising future research directions for GET2 studies?

Several promising research directions for GET2 studies warrant further investigation:

  • Structure-function relationships: Determining the high-resolution structure of GET2 and its complexes would significantly advance understanding of its mechanism. Cryo-electron microscopy and X-ray crystallography approaches, while challenging for membrane proteins, could reveal critical insights into trafficking mechanisms.

  • Dynamics and regulation: Investigating how GET2 activity is regulated under different cellular conditions, including stress responses and developmental stages, would illuminate its role in cellular adaptation. Single-molecule techniques could provide unprecedented detail about conformational changes during the trafficking cycle.

  • Interaction networks: Expanding our understanding of the complete GET2 interactome across different cellular contexts would help position this protein within the broader trafficking machinery. Proximity labeling approaches combined with quantitative proteomics offer powerful tools for this investigation.

  • Disease relevance: Exploring potential connections between GET2 dysfunction and disease processes, particularly in conditions involving secretory pathway stress, could reveal new therapeutic targets. Model organism studies could establish causal relationships between trafficking defects and disease phenotypes.

  • Synthetic biology applications: Engineering GET2-based tools for controlling protein trafficking could enable novel approaches to studying secretory pathway function or developing biotechnology applications. Optogenetic or chemically-induced dimerization systems could provide spatiotemporal control over trafficking events.

These research directions, while challenging, have the potential to significantly advance our understanding of fundamental cellular processes and potentially lead to new approaches for addressing trafficking-related diseases.

How can researchers contribute to standardizing protocols for GET2 research?

Researchers can contribute to standardizing protocols for GET2 research through several systematic approaches:

  • Develop and share detailed standard operating procedures (SOPs):

    • Document complete methodological details including buffer compositions, expression conditions, and quantification methods

    • Include troubleshooting guides addressing common issues

    • Specify quality control metrics and acceptance criteria

  • Establish community-wide resources:

    • Create repositories for validated plasmids, antibodies, and cell lines

    • Develop reference datasets for benchmarking new methods

    • Share analysis pipelines and software tools with clear documentation

  • Implement interlaboratory validation:

    • Organize multi-laboratory studies to assess reproducibility

    • Compare results across different experimental platforms

    • Identify sources of variability to guide future standardization efforts

  • Define reporting standards:

    • Establish minimum information guidelines for GET2-related publications

    • Create structured formats for sharing experimental details

    • Implement consistent nomenclature for GET2 variants and domains

  • Develop reference materials:

    • Produce and characterize standard protein preparations

    • Create calibration standards for quantitative assays

    • Establish reference cell lines with defined GET2 expression levels

By actively participating in these standardization efforts, researchers can accelerate progress in the field, improve reproducibility, and facilitate more effective collaboration across different research groups studying GET2 and related trafficking proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.