Recombinant Scheffersomyces stipitis NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MCR1; PICST_44816; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Target Names
MCR1
Target Protein Sequence
MSFSRSFSRLASSKFVLPVAAAAVGLASYSFTSSSFIANEPSKAFKGGDEWIDLKLISSH DLSHDTKHLVFELPNKDDVSGLVTASLLMTKFVTPKGSNVIRPYTPVSDTEQAGTIDFVV KKYEGGKMSSHIHDLKPNDTLSFKGPFVKWKWEPNQFKSIALIGGGTGITPLYQLIHEIT KNPADKTQVSLFYGSQTPDDILIKKELDALAAKHKDQVKIVYFVDKADASWKGETGYISK EFLQKNLPAPGPDNKIFVCGPPPLYKAVSGPKVSPTDQGELTGSLAELGFSKENVFKF
Uniprot No.

Target Background

Function
This protein may mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the genomic context of MCR1 in Scheffersomyces stipitis?

The MCR1 gene in S. stipitis is part of a genome characterized by high plasticity, with different isolates exhibiting distinct chromosome organizations. The gene exists within a genomic landscape that undergoes rapid adaptation to environmental changes, particularly under stress conditions. Genome sequencing using hybrid MinION Nanopore and Illumina technologies has revealed that S. stipitis contains retrotransposon-rich regions that facilitate chromosomal rearrangements . When studying MCR1, researchers should be aware that its genomic context may differ between S. stipitis isolates, potentially affecting expression patterns and regulation. The gene's position relative to these retrotransposon-rich regions could influence its stability and expression during adaptation experiments.

How does S. stipitis MCR1 differ from its homologs in Saccharomyces cerevisiae?

S. stipitis MCR1, as a NADH-cytochrome b5 reductase, functions within a metabolic framework fundamentally different from S. cerevisiae. Unlike S. cerevisiae which exhibits Crabtree-positive behavior (fermentation under glucose excess regardless of oxygen availability), S. stipitis is Crabtree-negative, with fermentation regulated by oxygen levels rather than sugar concentration . This respiratory preference is reflected in differences in the regulation and potentially structure of NADH-dependent enzymes including MCR1. Systems biology comparisons between these yeasts have shown that S. stipitis maintains similar flux distributions under both batch and chemostat conditions, while S. cerevisiae dramatically shifts its metabolic fluxes between respiratory and fermentative metabolism . The MCR1 gene likely participates in maintaining the higher TCA cycle and mitochondrial activities observed in S. stipitis compared to fermentative conditions in S. cerevisiae.

What are the basic biochemical properties of NADH-cytochrome b5 reductases?

For recombinant expression, understanding these properties is essential for designing assays with appropriate substrate concentrations and buffer conditions. Optimizing expression conditions requires monitoring both substrate (NADH) and product (NAD+) levels to account for potential inhibitory effects.

How does the metabolic context influence MCR1 activity in S. stipitis?

S. stipitis demonstrates a different metabolic network configuration compared to S. cerevisiae, particularly in respiratory metabolism. The flux distribution analysis shows consistently high TCA cycle fluxes in S. stipitis regardless of cultivation mode, although slightly higher during chemostat cultures than batch conditions . MCR1, as an NADH-dependent enzyme, operates within this metabolic context that maintains high respiratory activity.

The relative flux ratios between TCA cycle, pyruvate dehydrogenase (PDH), and pentose phosphate pathway (PPP) create a distinct redox environment for NADH-dependent enzymes in S. stipitis. For instance, the PDH flux in S. stipitis is slightly higher than that in S. cerevisiae during oxidative growth, suggesting greater mitochondrial acetyl-CoA formation through this route . This likely influences the NADH/NAD+ ratio and subsequently affects MCR1 activity. Researchers investigating MCR1 should consider these broader metabolic patterns when interpreting enzyme activity data.

What regulatory mechanisms control MCR1 expression in S. stipitis?

While the specific regulatory mechanisms controlling MCR1 in S. stipitis have not been fully characterized, comparative studies with S. cerevisiae provide insight. Regulatory proteins such as SNF1, GNC1, and HAP5 in S. stipitis share similarity to those in S. cerevisiae, but the regulatory mechanisms likely differ . Array-based expression studies have shown that about half of S. stipitis transcripts do not change significantly under different oxygen conditions or carbon sources .

For MCR1 specifically, regulation may be influenced by oxygen levels, as is the case for other NADH-dependent enzymes in S. stipitis, such as alcohol dehydrogenase (ADH). The activity of ADH is induced by reduced oxygen tension, possibly mediated by heme levels . Given MCR1's involvement in electron transport, similar oxygen-dependent regulation might exist. Researchers investigating MCR1 regulation should design experiments that control oxygen levels precisely and monitor expression responses across various growth conditions.

How can protein engineering be applied to modify the catalytic properties of S. stipitis MCR1?

Protein engineering of S. stipitis MCR1 requires understanding both the active site architecture and the regulatory domains of the enzyme. Based on studies of related NADH-dependent enzymes, several approaches can be considered:

  • Active site modifications to alter substrate specificity or reduce product inhibition

  • Engineering cofactor binding domains to modify NADH/NAD+ affinity

  • Altering regulatory domains to change response to cellular redox state

When designing mutations, researchers should consider the enzyme's reaction mechanism, which likely involves binding of NADH followed by reduction of cytochrome b5. Mixed product inhibition patterns observed in other NADH-dependent enzymes suggest ordered binding mechanisms , which would inform rational design strategies for MCR1.

Experimental validation should include steady-state kinetic analysis across varying substrate and product concentrations to fully characterize mutant enzymes. Particularly important is measuring activity under conditions that mimic the physiological environment of S. stipitis, including appropriate redox potentials and metabolite concentrations.

What expression systems are optimal for producing recombinant S. stipitis MCR1?

For recombinant expression of S. stipitis MCR1, several expression systems should be considered based on research objectives:

  • Escherichia coli expression: Provides high yields but may lack appropriate post-translational modifications. Use codon-optimized sequences to account for the difference in codon usage between S. stipitis (CTG(Ser1) clade) and E. coli .

  • Yeast expression systems: S. cerevisiae offers advantages for expression of eukaryotic proteins but may not properly process S. stipitis proteins due to different codon usage. Consider using S. stipitis itself as an expression host to maintain native processing.

  • Mammalian cell expression: For studies requiring authentic post-translational modifications, particularly if investigating protein-protein interactions with eukaryotic partners.

When designing expression constructs, include appropriate affinity tags for purification while ensuring they don't interfere with enzyme activity. For structural studies, consider tag placement that won't affect protein folding or dimerization.

What analytical techniques are most effective for characterizing recombinant S. stipitis MCR1?

Comprehensive characterization of recombinant MCR1 requires multiple analytical approaches:

  • Enzyme kinetics analysis: Steady-state kinetics with varying concentrations of NADH and cytochrome b5 to determine Km, Vmax, and potential substrate/product inhibition patterns .

  • Spectroscopic methods: UV-visible spectroscopy to monitor cofactor binding and redox state changes. Circular dichroism for secondary structure analysis.

  • Thermal stability assays: Differential scanning calorimetry or thermal shift assays to determine enzyme stability under various conditions.

  • Mass spectrometry: For precise molecular weight determination and identification of post-translational modifications.

  • Protein-protein interaction studies: Surface plasmon resonance or isothermal titration calorimetry to quantify interactions with cytochrome b5 and other potential partners.

When analyzing kinetic data, consider applying multiple models as substrate inhibition can be detected at low concentrations of NAD+ . Researchers should also account for potential activation by NAD+ at certain concentrations, as observed in other NADH-dependent enzymes.

How does S. stipitis MCR1 compare functionally to other yeasts' NADH-dependent reductases?

The functional comparison between S. stipitis MCR1 and other yeast NADH-dependent reductases must consider the broader metabolic context. The table below compares key metabolic parameters between S. stipitis and S. cerevisiae that influence NADH-dependent enzyme function:

ParameterS. cerevisiaeS. stipitisImplication for NADH-dependent enzymes
Maximum growth rate (μmax) [h-1]0.400.47Higher turnover of redox cofactors in S. stipitis
Glucose consumption rate [C-mmol/g DW/h]84.526.7Lower glycolytic flux in S. stipitis affects NADH generation
Biomass yield (Ysx) [g/g]0.170.55More efficient carbon utilization in S. stipitis
Ethanol yield (YsEtOH) [g/g]0.330.003Minimal fermentative NADH reoxidation in S. stipitis
TCA cycle fluxVariable (condition-dependent)Consistently highMore stable redox environment for MCR1 in S. stipitis

Data compiled from

These metabolic differences suggest that S. stipitis MCR1 operates in an environment with more consistent NADH/NAD+ ratios across growth conditions, potentially requiring different regulatory mechanisms compared to S. cerevisiae homologs.

What is the role of MCR1 in the genome plasticity and adaptive responses of S. stipitis?

S. stipitis exhibits remarkable genome plasticity with extensive genomic changes offering fitness benefits detected during evolution experiments . While MCR1's specific role in this adaptability hasn't been directly characterized, its function as an NADH-dependent reductase places it at a critical junction in cellular redox metabolism.

During adaptation to hostile environments, S. stipitis undergoes chromosome reshuffling mediated by retrotransposons . These genomic rearrangements could potentially affect MCR1 expression if it is located near retrotransposon-rich regions or if regulatory elements controlling its expression are modified during chromosomal rearrangements.

The adaptive value of MCR1 may lie in maintaining redox balance during metabolic shifts required for growth on different carbon sources, particularly when transitioning between hexose and pentose sugars—a capability that makes S. stipitis valuable for biofuel production.

How might genetic modifications of MCR1 improve biofuel production capabilities in S. stipitis?

S. stipitis holds enormous potential for second-generation biofuel production from forestry and agricultural waste . MCR1, as a component of the electron transport system, could be a target for genetic modification to enhance this capability in several ways:

  • Overexpression of MCR1 might improve NADH recycling efficiency, potentially enhancing respiratory capacity and growth rate on lignocellulosic hydrolysates.

  • Engineering MCR1 variants with altered substrate specificity or regulation could modify the redox balance to favor specific metabolic pathways supporting biofuel production.

  • Integration of MCR1 modifications with genome plasticity studies could develop more robust S. stipitis strains that maintain optimal redox balance even under stress conditions encountered in industrial processes.

When designing such modifications, researchers should consider the intrinsic genome plasticity of S. stipitis, which might affect the stability of genetic modifications over multiple generations . Strategies to ensure stable expression, such as integration at multiple genomic loci or selection of integration sites away from retrotransposon-rich regions, should be explored.

What systems biology approaches best elucidate MCR1's role in the metabolic network of S. stipitis?

Comprehensive understanding of MCR1's role requires integrating multiple systems biology approaches:

  • Flux analysis using 13C-labeled substrates to determine metabolic flux distribution in MCR1 mutants compared to wild-type, focusing on changes in the redox cofactor-dependent pathways.

  • Metabolomics to identify changes in metabolite levels, particularly those related to redox metabolism. Special attention should be paid to metabolites showing high fold-changes between S. stipitis and S. cerevisiae, such as citramalate .

  • Transcriptomics through RNA-seq to analyze global expression changes in response to MCR1 modification, potentially revealing regulatory networks connected to MCR1 function.

  • In silico analysis of transcription factors to identify regulatory elements controlling MCR1 expression under different environmental conditions, similar to approaches used to compare S. stipitis and S. cerevisiae .

  • Proteomics to detect changes in protein levels and post-translational modifications affecting MCR1 activity or its interaction partners.

Integration of these data types requires sophisticated computational approaches, including genome-scale metabolic models incorporating enzyme kinetics data for MCR1 and related enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.