Recombinant Scheffersomyces stipitis Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional fees apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LCL3; PICST_29232; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Target Names
LCL3
Target Protein Sequence
MAPIPQNSSTEVSLLHPKVLLLSAGITTTAFLSYKFHQRYVTRLRTYLDITPKILDNQQK LYGYVTRVGDGDNFRFFHTPGGVFMGWGWLRKIPTNRNQLKDETLMIRLCGVDAPERSHW GKPAQPFSEEALIWLSSYVGKRYVTVTPFSIDQYKRLVARAQVWKWTGKKDVSAEMIRQG LGIVYEGKSGAEFGDNEALYRNLEAKAKRQKKGVWSLGKKMTTPGEFKREHYRGD
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of LCL3 endonuclease in Scheffersomyces stipitis?

LCL3 in S. stipitis is classified as a probable endonuclease based on sequence homology analysis. Endonucleases typically cleave phosphodiester bonds within polynucleotide chains, playing crucial roles in DNA repair, recombination, and restriction mechanisms. In S. stipitis, LCL3 (UniProt ID: A3GI61) is predicted to participate in nucleic acid metabolism, though its precise substrate specificity and biological role require further characterization. The protein contains motifs consistent with metal-dependent nuclease activity, suggesting it may require divalent cations like Mg²⁺ or Mn²⁺ for optimal function. Researchers investigating LCL3 should initially verify its endonuclease activity through in vitro cleavage assays using various DNA substrates to confirm its presumed function.

How is recombinant LCL3 protein typically expressed and purified?

The recombinant LCL3 protein is most commonly expressed in E. coli expression systems, which provide high yield and relative simplicity. The protein-coding sequence is typically cloned into expression vectors that incorporate an N-terminal His-tag to facilitate purification. The methodology involves:

  • Gene amplification: PCR amplification of the LCL3 gene from S. stipitis genomic DNA

  • Vector construction: Cloning into an appropriate expression vector, such as those in the pET series

  • Transformation: Introduction into an E. coli expression strain (typically BL21(DE3) or derivatives)

  • Induction: IPTG-induced expression under optimized conditions (temperature, duration)

  • Lysis: Cell disruption by sonication or chemical methods

  • Purification: Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Quality control: SDS-PAGE analysis to confirm purity (>90% is typical)

The purified protein is typically obtained as a lyophilized powder after buffer exchange and freeze-drying, which ensures stability during storage.

What are the optimal storage conditions for recombinant LCL3 protein?

For long-term storage of recombinant LCL3, the following conditions are recommended:

  • Primary storage: Store lyophilized protein at -20°C or preferably -80°C upon receipt

  • Working aliquots: For reconstituted protein, store at 4°C for up to one week

  • Reconstitution buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Cryoprotection: Addition of glycerol (final concentration 5-50%, with 50% being optimal) for reconstituted samples

  • Aliquoting: Division into single-use aliquots to avoid repeated freeze-thaw cycles

Researchers should note that repeated freeze-thaw cycles significantly reduce enzymatic activity. The presence of trehalose in the storage buffer helps maintain protein stability during freeze-drying and subsequent reconstitution. For optimal activity preservation, reconstituted protein should be stored at -80°C in small aliquots with glycerol as a cryoprotectant.

What is the role of LCL3 in Scheffersomyces stipitis metabolism?

S. stipitis is recognized for its capacity to ferment pentose sugars and efficiently utilize various carbon sources, including xylose, which makes it valuable for lignocellulosic biomass conversion. While the precise metabolic role of LCL3 has not been fully elucidated, several hypotheses exist:

  • Nucleic acid turnover: LCL3 may participate in DNA/RNA degradation during nutrient limitation

  • Stress response: It might function in the cellular response to environmental stressors

  • Metabolic adaptation: Potentially involved in adaptation to different carbon sources

The expression pattern of LCL3 during growth on different sugars (glucose, xylose, etc.) could provide clues to its metabolic significance. Systems biology approaches comparing S. stipitis with other yeasts suggest that unique enzymes like LCL3 may contribute to its distinctive metabolic capabilities, particularly in relation to pentose sugar utilization and fermentation under oxygen-limited conditions.

How can researchers investigate the substrate specificity of LCL3 endonuclease?

Determining the substrate specificity of LCL3 requires a systematic approach:

  • Substrate panel testing: Examining activity against various nucleic acid substrates:

    • Single-stranded DNA of different sequences

    • Double-stranded DNA with varying GC content

    • RNA substrates

    • Circular versus linear DNA

  • Cleavage site mapping: Using techniques such as:

    • Primer extension analysis

    • High-resolution gel electrophoresis

    • Sequencing of cleavage products

  • Kinetic analysis: Determining kinetic parameters (Km, kcat, kcat/Km) for different substrates to quantify preference

  • Cofactor requirements: Testing the dependency on various metal ions:

Metal IonConcentration RangeRelative Activity (%)
Mg²⁺0.5-10 mM100 (reference)
Mn²⁺0.5-10 mM75-120 (estimated)
Ca²⁺0.5-10 mM10-30 (estimated)
Zn²⁺0.5-10 mM5-15 (estimated)
  • Structural biology approaches: Using X-ray crystallography or cryo-EM to visualize substrate binding

These methodologies provide complementary information about substrate recognition and catalytic mechanism, enabling a comprehensive characterization of LCL3's enzymatic behavior in vitro.

How does LCL3 expression correlate with S. stipitis growth on different carbon sources?

S. stipitis is notable for its ability to metabolize a wide range of sugars, including glucose, xylose, and other pentoses. The expression of LCL3 may vary depending on the carbon source, which can be investigated through:

  • Transcriptomic analysis: RNA-seq or microarray analysis of S. stipitis grown on different carbon sources can reveal transcriptional regulation of LCL3. Previous studies on S. stipitis have shown significant transcriptional remodeling when switching between glucose and xylose, suggesting enzymes like LCL3 may be differentially regulated.

  • Proteomic profiling: Quantitative proteomics can determine if LCL3 protein levels change in response to different carbon sources. This approach can reveal post-transcriptional regulation mechanisms.

  • Reporter gene assays: Constructing promoter-reporter fusions to directly measure LCL3 promoter activity under various growth conditions.

  • Correlation with metabolic state: Data suggests that S. stipitis exhibits different metabolic profiles depending on the sugar composition of the medium, which may influence LCL3 expression:

Carbon SourceOxygen ConditionExpected LCL3 ExpressionMetabolic State
GlucoseAerobicBaselineRespiratory
GlucoseMicroaerobicPotentially elevatedMixed
XyloseAerobicPotentially elevatedRespiratory
XyloseMicroaerobicPotentially elevatedFermentative
Mixed sugarsMicroaerobicComplex regulationMixed

Understanding the expression patterns of LCL3 across different growth conditions could provide insights into its physiological role and potential involvement in alternative carbon source utilization.

What experimental approaches are recommended for characterizing LCL3 enzymatic activity?

A comprehensive characterization of LCL3 enzymatic activity should include:

  • Spectrophotometric assays: Continuous monitoring of nuclease activity using substrates that release quantifiable products:

    • Hyperchromicity assays measuring increased absorbance at 260 nm as DNA is degraded

    • Coupled enzyme assays that link nuclease activity to a colorimetric or fluorometric readout

  • Gel-based assays:

    • Plasmid nicking assays to monitor conversion between supercoiled, nicked, and linear forms

    • Denaturing polyacrylamide gel electrophoresis to identify specific cleavage products

  • Binding studies:

    • Electrophoretic mobility shift assays (EMSA)

    • Surface plasmon resonance (SPR) to determine binding affinity

    • Fluorescence anisotropy with labeled DNA substrates

  • Structure-function analysis:

    • Site-directed mutagenesis of predicted catalytic residues

    • Truncation analysis to identify functional domains

    • Chimeric proteins with related endonucleases

  • Reaction condition optimization:

ParameterRange to TestExpected Optimal Conditions
pH5.0-9.0 (0.5 increments)7.0-8.0
Temperature25-50°C (5°C increments)30-37°C
Salt (NaCl)0-300 mM (50 mM increments)50-150 mM
Divalent cations0-10 mM (1 mM increments)1-5 mM Mg²⁺ or Mn²⁺
Reducing agents0-10 mM DTT/β-ME1-5 mM

These approaches collectively provide a detailed understanding of LCL3's catalytic properties, substrate preferences, and optimal reaction conditions.

What are the potential applications of LCL3 in lignocellulosic biomass conversion?

S. stipitis is extensively studied for its ability to ferment lignocellulosic biomass components, particularly xylose. While LCL3 as an endonuclease is not directly involved in sugar metabolism, it may have several potential applications in biomass conversion:

  • Nucleic acid processing in biomass pretreatment: Enzymatic cocktails for biomass processing might benefit from nucleases that break down DNA/RNA released during pretreatment, potentially reducing viscosity and improving hydrolysis efficiency.

  • Molecular tool for strain engineering: Understanding and manipulating LCL3 could contribute to the development of improved S. stipitis strains with enhanced fermentation capabilities. The metabolic engineering of S. stipitis has already shown promise for improving ethanol production from lignocellulosic materials.

  • Biorefinery process optimization: Insights from studying LCL3 regulation may inform process optimization strategies:

Biorefinery Process StagePotential Role of LCL3 Knowledge
Biomass pretreatmentDNA/RNA degradation during cell lysis
Hydrolysate fermentationStrain optimization for stress response
Metabolic engineeringTarget for expression modification
Process monitoringPotential biomarker for cellular state
  • Comparative studies with other yeasts: Understanding the differences between S. stipitis and other yeasts like S. cerevisiae through proteins such as LCL3 can inform better strain development strategies. S. stipitis shows significant advantages over S. cerevisiae in pentose fermentation, making it valuable for complete sugar utilization in lignocellulosic hydrolysates.

  • Integration with other bioprocesses: Research on S. stipitis has expanded to include production of high-value compounds such as resveratrol, suggesting that understanding cellular components like LCL3, especially in relation to stress responses, could benefit diverse bioprocessing applications.

How does the expression of LCL3 change under different fermentation conditions?

The expression of LCL3 under various fermentation conditions would be expected to follow patterns similar to other metabolic genes in S. stipitis, which are known to respond to both carbon source and oxygen availability:

  • Oxygen-dependent regulation: S. stipitis is a Crabtree-negative yeast, meaning its fermentation is not triggered by high sugar concentrations but rather by oxygen limitation. LCL3 expression may be influenced by oxygen availability:

Oxygen ConditionExpected LCL3 Expression PatternMetabolic State
AerobicBaseline expressionRespiratory
MicroaerobicPotentially alteredMixed
AnaerobicPotentially repressedLimited growth
  • Carbon source effects: Different carbon sources may trigger varying expression patterns:

Carbon SourcePotential Effect on LCL3 Expression
GlucoseReference level
XylosePotentially upregulated
Mixed sugarsComplex regulation patterns
MolassesContext-dependent regulation
  • Carbon catabolite repression effects: Studies on S. stipitis have shown that the presence of different sugars (sucrose, glucose, fructose) can cause catabolite repression, affecting the intracellular accumulation of glycolytic metabolites and energy compounds like AMP. These metabolic shifts could indirectly influence LCL3 expression through general stress responses or specific regulatory pathways.

  • Fermentation phase-dependent expression: Expression might vary across different growth phases:

    • Lag phase: Potential baseline expression

    • Exponential phase: Expression adjusted to metabolic demands

    • Stationary phase: Possible induction in response to stress

Experimental approaches including RT-qPCR, RNA-seq, and proteomics under controlled fermentation conditions would be required to definitively characterize these expression patterns.

What are the recommended protocols for reconstituting lyophilized LCL3 protein?

For optimal reconstitution of lyophilized LCL3 protein:

  • Pre-reconstitution steps:

    • Centrifuge the vial briefly to collect all material at the bottom

    • Allow the vial to reach room temperature before opening

    • Handle in a clean environment to prevent contamination

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Gently mix by swirling or inversion (avoid vigorous shaking or vortexing)

    • Allow 5-10 minutes for complete dissolution

    • For challenging reconstitution, consider brief incubation at room temperature

  • Post-reconstitution preparation:

    • Add glycerol to a final concentration of 5-50% (50% recommended) for cryoprotection

    • Create single-use aliquots to avoid repeated freeze-thaw cycles

    • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage

  • Quality control:

    • Verify protein concentration using spectrophotometric methods

    • Assess purity by SDS-PAGE if necessary

    • Validate activity using appropriate enzymatic assays

The reconstitution buffer should be compatible with the Tris/PBS-based storage buffer (pH 8.0) containing 6% trehalose. This approach minimizes protein denaturation and activity loss during the reconstitution process.

How can researchers validate the activity of recombinant LCL3 in vitro?

Validating the endonuclease activity of recombinant LCL3 requires multiple complementary approaches:

  • Plasmid nicking/linearization assays:

    • Incubate purified LCL3 with supercoiled plasmid DNA

    • Analyze the conversion from supercoiled to nicked and linear forms via agarose gel electrophoresis

    • Compare with commercial endonucleases as positive controls

  • Synthetic substrate assays:

    • Use defined oligonucleotide substrates with fluorescent labels or quenchers

    • Monitor cleavage through fluorescence enhancement or FRET-based methods

    • Calculate initial velocities to determine kinetic parameters

  • Activity titration:

LCL3 Concentration (nM)Expected Activity (% substrate cleaved in 30 min)
15-15%
1020-40%
10060-90%
1000>95%
  • Cofactor requirements verification:

    • Test activity with and without divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

    • Determine optimal cofactor concentration for maximal activity

    • Investigate inhibition by chelating agents (EDTA, EGTA)

  • Specificity controls:

    • Test activity against different nucleic acid types (ssDNA, dsDNA, RNA)

    • Compare cleavage patterns with those of characterized endonucleases

    • Validate that heat-inactivated LCL3 shows no activity

These methods collectively provide robust evidence of endonuclease activity and establish baseline parameters for further characterization studies.

How does the His-tag affect LCL3 function, and should it be removed for certain applications?

The N-terminal His-tag on recombinant LCL3 serves primarily as a purification tool but may influence protein characteristics:

  • Potential effects of the His-tag:

    • Altered surface charge due to the positively charged histidine residues

    • Possible interference with N-terminal structural elements

    • Potential impact on protein solubility or stability

    • Possible influence on substrate binding if the N-terminus is near the active site

  • Applications where His-tag removal may be beneficial:

    • Structural studies (X-ray crystallography, NMR)

    • Detailed kinetic analyses requiring native protein conformation

    • In vivo functional studies where the tag might affect localization or interactions

    • Therapeutic applications where the tag might trigger immunogenic responses

  • Methods for His-tag removal:

    • Enzymatic cleavage using specific proteases (e.g., TEV protease, thrombin)

    • Incorporation of a cleavage site between the tag and protein during vector design

    • Reverse IMAC to remove the cleaved His-tag

  • Comparative activity assessment:

ParameterHis-tagged LCL3Tag-removed LCL3Notes
Specific activityReference valuePotentially higherDepends on tag interference
Substrate affinityPotentially alteredNativeImportant for Km determination
StabilityPossibly enhancedNativeTag can increase solubility
CrystallizabilityReducedEnhancedCritical for structural studies
  • Decision matrix for tag removal:

    • For basic enzymatic characterization: Tag retention is acceptable

    • For detailed structural studies: Tag removal recommended

    • For in vivo studies: Context-dependent decision

Researchers should empirically determine the impact of the His-tag on their specific application by comparing the activity of tagged and untagged versions where critical.

What assays are available for monitoring LCL3 endonuclease activity?

Several assay formats can be employed to monitor LCL3 endonuclease activity:

  • Gel-based assays:

    • Plasmid relaxation/linearization: Visualize the conversion of supercoiled plasmid to nicked and linear forms

    • Denaturing PAGE: Analyze specific cleavage patterns using labeled oligonucleotides

    • Two-dimensional gel electrophoresis: Map cleavage sites in complex substrates

  • Solution-based assays:

    • Hyperchromicity: Monitor increase in UV absorbance at 260 nm as DNA is cleaved

    • Fluorescence-based: Use fluorophore-quencher pairs separated by cleavage

    • PicoGreen assay: Quantify dsDNA degradation through decreased fluorescence

  • Real-time monitoring systems:

    • Surface plasmon resonance (SPR): Detect substrate binding and product release

    • Biolayer interferometry: Monitor reaction kinetics without labels

    • Isothermal titration calorimetry: Measure the thermodynamics of enzyme-substrate interactions

  • High-throughput compatible formats:

    • Microplate fluorescence assays: Screen multiple conditions simultaneously

    • FRET-based assays: Monitor distance-dependent energy transfer disruption

    • Molecular beacon substrates: Self-reporting substrates that fluoresce upon cleavage

  • Advanced analytical methods:

    • Mass spectrometry: Identify exact cleavage sites and modifications

    • Capillary electrophoresis: High-resolution separation of cleavage products

    • Next-generation sequencing: Comprehensive mapping of cleavage preferences

Each assay type offers different advantages in terms of sensitivity, throughput, and information content. Selection should be based on the specific research question and available equipment.

What challenges exist in studying LCL3 in the context of S. stipitis metabolism?

Investigating LCL3 within the native S. stipitis context presents several challenges:

  • Genetic manipulation limitations:

    • S. stipitis has fewer established genetic tools compared to model yeasts like S. cerevisiae

    • Transformation efficiency is typically lower

    • Limited availability of selection markers and promoter systems

    • Challenges in controlling gene expression levels

  • Growth and cultivation considerations:

    • S. stipitis requires microaerobic conditions for optimal fermentation

    • Growth rates are generally slower than S. cerevisiae

    • Media composition significantly affects metabolic state

    • Carbon catabolite repression complicates interpretation of metabolic studies

  • Systems biology integration:

    • Incomplete understanding of regulatory networks in S. stipitis

    • Limited proteomic and metabolomic datasets compared to model organisms

    • Complex interactions between carbon metabolism and oxygen sensing

    • Difficulty in distinguishing primary from secondary effects in gene perturbation studies

  • Methodological challenges:

    • Protein extraction efficiency may vary with growth conditions

    • Post-translational modifications may affect LCL3 function in vivo

    • Subcellular localization studies require specialized tools

    • In vitro findings may not fully represent in vivo activity

  • Comparative analysis limitations:

    • Different fermentation conditions lead to different metabolic states

    • Strain variations complicate cross-study comparisons

    • Limited standardization of experimental conditions across literature

Researchers studying LCL3 in S. stipitis should consider these challenges when designing experiments and interpreting results. Integrating complementary approaches, including heterologous expression, in vitro characterization, and in vivo studies, provides the most comprehensive understanding.

How might LCL3 contribute to biofuel production pathways in Scheffersomyces stipitis?

While LCL3 as an endonuclease is not directly involved in primary metabolism, several research avenues could explore its indirect contributions to biofuel production:

  • Stress response and adaptation: Investigating whether LCL3 participates in cellular adaptation to fermentation stresses could reveal strategies to improve S. stipitis robustness in industrial settings. Stress-tolerant strains typically show enhanced biofuel production capacity under challenging conditions.

  • Metabolic engineering targets: Understanding the regulatory network involving LCL3 could identify novel engineering targets:

Potential RoleResearch ApproachExpected Outcome
Stress response componentGene deletion/overexpressionModified stress tolerance
DNA/RNA turnover during nutrient limitationControlled expression studiesImproved nutrient utilization
Signaling pathway componentPhosphoproteomicsNovel regulatory insights
  • Integration with systems biology models: Incorporating LCL3 function into genome-scale metabolic models of S. stipitis could improve predictive capabilities for strain engineering. Flux balance analysis has already been applied to predict metabolic behaviors in S. stipitis, and including regulatory elements could enhance model accuracy.

  • Cross-species comparative analysis: Determining whether LCL3 homologs exist in other biofuel-producing yeasts could reveal evolutionary adaptations relevant to fermentation capacity. S. stipitis shows distinctive metabolic capabilities compared to S. cerevisiae, particularly in pentose utilization, which may involve unique enzymes like LCL3.

  • Synthetic biology applications: Engineering LCL3 variants with modified properties could potentially create novel functionalities beneficial for bioprocess optimization. The existing tools for recombinant expression of S. stipitis proteins provide a foundation for such engineering efforts.

What genomic and proteomic approaches are useful for studying LCL3 regulation?

Modern omics technologies offer powerful approaches to study LCL3 regulation:

  • Transcriptomic analysis:

    • RNA-seq to profile expression under various conditions

    • 5' RACE to identify transcription start sites and regulatory elements

    • ChIP-seq to identify transcription factors binding to the LCL3 promoter

    • ATAC-seq to assess chromatin accessibility near the LCL3 locus

  • Proteomic approaches:

    • Quantitative proteomics to measure protein abundance changes

    • Phosphoproteomics to identify regulatory post-translational modifications

    • Protein-protein interaction studies (Co-IP, BioID, proximity labeling)

    • Protein turnover analysis using pulse-chase experiments

  • Metabolomic integration:

    • Correlating LCL3 expression with metabolic profiles

    • Identifying metabolites that may allosterically regulate LCL3

    • Flux analysis to determine metabolic contexts where LCL3 is active

  • Systems biology integration:

    • Genome-scale models incorporating regulatory information

    • Network analysis to position LCL3 within cellular response pathways

    • Multi-omics data integration for contextual understanding

  • Comparative genomics:

    • Analysis of LCL3 promoter regions across related species

    • Identification of conserved regulatory elements

    • Evolutionary analysis of selection pressure on LCL3

Previous studies have demonstrated that S. stipitis exhibits significant transcriptional remodeling when transitioning between carbon sources, suggesting that regulatory elements controlling LCL3 could be identified through carefully designed omics experiments.

How might CRISPR-Cas9 be utilized to study LCL3 function in Scheffersomyces stipitis?

CRISPR-Cas9 technology offers powerful approaches for investigating LCL3 function:

  • Gene knockout studies:

    • Complete deletion of LCL3 to assess phenotypic consequences

    • Creation of conditional knockouts using inducible CRISPR systems

    • Marker-free editing to avoid confounding effects

  • Precise genetic modifications:

    • Introduction of point mutations to disrupt catalytic residues

    • Creation of domain deletions or swaps to assess structure-function relationships

    • Tagging with fluorescent proteins for localization studies

  • Regulatory element analysis:

    • Targeted modifications of LCL3 promoter regions

    • CRISPR interference (CRISPRi) to modulate expression without sequence changes

    • CRISPR activation (CRISPRa) to enhance expression

  • Multiplexed genetic analysis:

    • Simultaneous modification of LCL3 and related genes

    • Creation of synthetic genetic interaction maps

    • Combinatorial promoter engineering

  • High-throughput functional genomics:

    • CRISPR screens to identify genetic interactions with LCL3

    • Base editing for systematic mutational analysis

    • Prime editing for precise sequence modifications without double-strand breaks

While CRISPR-Cas9 implementation in S. stipitis may require optimization of delivery methods, guide RNA design, and selection strategies, the approach offers unprecedented precision for genetic manipulation. This technology could overcome traditional limitations in studying non-conventional yeasts and accelerate functional characterization of enzymes like LCL3.

What are the potential interactions between LCL3 and the distinctive pentose fermentation pathways in S. stipitis?

S. stipitis is renowned for its ability to ferment pentose sugars, particularly xylose. Investigating potential connections between LCL3 and these pathways could reveal unexpected relationships:

  • Regulatory network analysis: LCL3 may be co-regulated with genes involved in xylose metabolism. S. stipitis has an XR-XDH pathway for xylose utilization that is distinct from other yeasts, and the regulation of this pathway involves complex transcriptional responses to sugar availability and oxygen limitation.

  • Metabolic stress response: Pentose fermentation creates unique metabolic stresses that might trigger responses involving LCL3. Research has shown that S. stipitis must carefully balance NAD(P)H regeneration during xylose fermentation, creating specific redox challenges.

  • Comparative expression analysis:

Growth ConditionExpected LCL3 Expression PatternPentose Pathway Activity
Glucose aerobicBaselineLow
Glucose anaerobicPotentially alteredLow
Xylose aerobicPotentially upregulatedHigh
Xylose anaerobicComplex regulationHigh
Mixed sugarsCondition-dependentVariable
  • Cellular localization studies: Determining if LCL3 colocalizes with pentose metabolism enzymes could suggest functional relationships. Many metabolic enzymes form dynamic complexes or compartments in response to changing conditions.

  • Genetic interaction mapping: Synthetic genetic array analysis with LCL3 deletion/modification and pentose pathway components could reveal functional relationships. Genetic interactions often indicate pathway connections that are not apparent from sequence analysis alone.

The unique metabolic capabilities of S. stipitis likely involve complex regulatory networks that integrate carbon source sensing, oxygen availability, and stress responses. Understanding how LCL3 fits within these networks could provide valuable insights for metabolic engineering applications.

How does LCL3 function compare between different yeast species?

Comparative analysis of LCL3 across yeast species could provide evolutionary and functional insights:

  • Phylogenetic analysis: LCL3 homologs appear to have divergent distribution among yeasts. Some endonuclease families show significant diversification across yeast lineages, potentially reflecting adaptation to different ecological niches.

  • Functional conservation assessment: Expression of LCL3 homologs from different species in a common host could reveal functional conservation or divergence. Such heterologous expression studies are valuable for understanding enzyme evolution.

  • Species-specific adaptations:

Yeast SpeciesLCL3 Homolog StatusMetabolic CharacteristicsPotential Functional Significance
S. stipitisPresent (A3GI61)Efficient pentose utilizationPossible role in adaptation to lignocellulosic substrates
S. cerevisiaeDistant homologs onlyLimited pentose utilizationDifferent nucleic acid metabolism strategies
P. pastorisUnknownMethanol utilizationPotentially different regulatory network
Y. lipolyticaUnknownLipid metabolismPotentially different cellular roles
  • Expression pattern comparison: Analyzing whether LCL3 homologs show similar or divergent expression patterns across species could indicate functional conservation or neofunctionalization.

  • Structural comparison: Homology modeling of LCL3 proteins from different species could reveal conserved catalytic domains and species-specific structural features. Such analysis can identify critical residues under evolutionary constraint.

S. stipitis has several unique metabolic features compared to conventional yeasts like S. cerevisiae, including its Crabtree-negative nature and efficient pentose utilization. Understanding how enzymes like LCL3 contribute to these distinctive traits through comparative analysis could provide valuable insights for both basic science and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.