Recombinant Schistocerca americana Innexin inx1 (inx1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
inx1; Innexin inx1; Innexin-1; G-Inx1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Schistocerca americana (American grasshopper)
Target Names
inx1
Target Protein Sequence
MYKLLGGLKEYLKWQDIVTDNAIFRLHNLFTTVLLLTCSLIITATQYVGNPIHCIVNGLP VRPINTYCWITSTFTMPDAFLRQVGSEVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQA MLCYTPKWIWDSIEGGLLRTLIMGLNRGLCQDDEKCMKKKALIEYLLRHIKRHNMYALKY WFCETLCLVNIIGQLYLMNHFFDGEFFSYGLRVVAFSEQSQEERVDPMVYVFPRVTKCTF HKYGASGSIQKHDSLCVLPLNIVNEKTYIFLWFWYIILAALLSVLVVYRAVILAVPSVRP ILLHARNRMVPKEVTNAICRKTDVGDWWILYMLGRNMDPMIYGEVIADLAKKIETPSSNN P
Uniprot No.

Target Background

Function
Structural components of the gap junctions.
Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in embryonic neural precursors including the dorsal median neuroblast, glial cells, neuropilar glial ring, developing myoblasts cells and in a circumferential band of epithelial cells at the trochanter/coxa boundary stripe in the developing limb

Q&A

What is Innexin inx1 and what is its role in Schistocerca species?

Innexins are transmembrane proteins that form gap junction channels in invertebrates, providing one of the most common forms of intercellular communication. In Schistocerca gregaria, a species closely related to S. americana, innexin genes (including Sg-inx1) are expressed in the frontal ganglion (FG) and other parts of the nervous system . These proteins establish functional electrical coupling between neurons in the FG, which is essential for rhythm-generating networks and their role in behavior . Immunohistochemistry studies have revealed that some neurons in the FG express at least one innexin protein, INX1 .

How conserved are innexin proteins across invertebrate species?

Innexin proteins are highly conserved across invertebrate species, representing one of the most conserved cellular structures in multicellular organisms. Gap junctions likely serve similar functions in all Metazoa . For example, analysis of innexin genes in the mud crab Scylla paramamosain revealed high homology with innexin3 of Cancer boredis and Homorus americanus . Similarly, phylogenetic analysis of Lymnaea stagnalis innexins showed that they originated from a single copy in the common ancestor of molluskan species and have diversified through multiple gene duplication events . This high degree of conservation makes it possible to use degenerate primers designed for one species (e.g., Cancer borealis) to successfully amplify innexin sequences in other species (e.g., Lymnaea stagnalis) .

What are the expression patterns of innexin genes in invertebrate nervous systems?

Innexin genes show distinctive expression patterns in invertebrate nervous systems. In Schistocerca gregaria, four innexin genes (Sg-inx1, Sg-inx2, Sg-inx3, and Sg-inx4) are expressed in the frontal ganglion . In Scylla paramamosain, Sp-inx3 is predominantly expressed in the eyestalk, brain, and thoracic ganglion mass in both female and male crabs . Immunohistochemistry assays have shown widespread and intense immunoreactivity of Sp-inx3 in the brain and thoracic ganglion mass . In Lymnaea stagnalis, eight innexin genes (Lst Inx1–Lst Inx8) have been identified, with paralogous genes demonstrating distinct expression patterns among tissues . Notably, Lst Inx1 exhibits heterogeneity in cells and ganglia, suggesting functional diversification after gene duplication .

What techniques are effective for cloning and sequencing innexin genes?

Based on published research, an effective approach for cloning and sequencing innexin genes involves:

  • RNA extraction from target tissue (typically nervous system components)

  • cDNA synthesis using reverse transcriptase (e.g., SuperScript II Reverse Transcriptase)

  • PCR amplification using degenerate primers targeting conserved regions of innexin genes

  • Cloning of PCR products into a suitable vector (e.g., pMD-18T)

  • Sequencing of cloned fragments

  • RACE PCR to obtain the full-length cDNA sequence

For example, in S. paramamosain, degenerate primers based on Cancer borealis innexin1 gene were used to obtain a partial sequence, followed by RACE PCR to obtain the full-length cDNA sequence . Similarly, in L. stagnalis, degenerate primers designed for innexin detection in Cancer borealis successfully amplified a partial sequence, which was then used to design primers for 3' and 5' RACE to obtain a complete mRNA transcript .

How can recombinant innexin proteins be expressed and purified for functional studies?

While the provided search results don't specifically detail expression and purification methods for recombinant innexin proteins, a research-based approach would typically include:

  • Cloning the full-length coding sequence into an expression vector

  • Transformation into a suitable expression system (bacterial, insect, or mammalian cells)

  • Optimization of expression conditions (temperature, induction time, etc.)

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (His-tag, GST-tag, etc.)

  • Verification of protein integrity and function

For membrane proteins like innexins, mammalian or insect cell expression systems are often preferred over bacterial systems to ensure proper folding and post-translational modifications. Detergent optimization is critical for solubilization while maintaining protein structure and function.

What RNA interference (RNAi) approaches have been successful for studying innexin function?

RNAi has been successfully employed to decrease innexin expression in several invertebrate species:

SpeciesInnexin TargetReduction LevelReference
Desert locust (S. gregaria)Inx174%
Desert locust (S. gregaria)Inx285%
Desert locust (S. gregaria)Inx395%
Desert locust (S. gregaria)Inx465%
LeechHm-inx1>80%
Anopheles mosquitoesAGAP00147660%

These approaches demonstrate that RNAi can effectively reduce innexin expression, providing a valuable tool for functional studies. The high knockdown efficiency (up to 95% for Inx3 in S. gregaria) makes this technique particularly useful for studying the physiological roles of innexins in neural communication and development .

How can electrophysiological methods be used to characterize innexin channel properties?

Electrophysiological methods are essential for characterizing the functional properties of innexin channels. Based on research in Schistocerca gregaria, the following approaches have been successfully used:

  • Patch-clamp recordings: To measure single-channel conductance, voltage dependence, and gating properties of innexin channels.

  • Dye coupling experiments: To assess the permeability of gap junctions to fluorescent dyes of different molecular weights, providing insights into channel selectivity.

  • Dual whole-cell recordings: To measure electrical coupling between neurons expressing innexins, as demonstrated in the frontal ganglion of S. gregaria .

  • Pharmacological manipulation: Application of gap junction blockers (e.g., carbenoxolone, octanol) to verify that observed coupling is mediated by gap junctions.

These techniques have established the presence of functional gap junction proteins in the frontal ganglion and demonstrated functional electrical coupling between neurons in the frontal ganglion of S. gregaria , providing a foundation for similar studies in S. americana.

What is known about the developmental regulation of innexin expression?

Innexin expression shows dynamic regulation during development in invertebrates. In Scylla paramamosain, analysis of Sp-inx3 transcription profiles at different development stages revealed distinct patterns . Similarly, Sp-inx2 mRNA was not detected in the earliest embryonic period, and its transcription level gradually increased from the embryo1 period to the zoea larvae stage I . The transcription level of Sp-inx3 was significantly higher than that of Sp-inx2 from the embryo1 period to the pre-hatching period (P<0.05) while it was lower in the zoea larvae 1 .

Gap junctions are widely distributed in embryonic cells and tissues and have been attributed an important role in development, modulating cell growth and differentiation . In Rhynchosciara americana, analysis of the expression profile of innexin-2 shows that it can participate in many physiological processes during development .

How do post-translational modifications affect innexin channel function?

While the provided search results don't directly address post-translational modifications of innexins, research on related gap junction proteins suggests these modifications play crucial roles in:

  • Channel assembly and trafficking

  • Channel gating and conductance

  • Protein-protein interactions

  • Regulation of channel degradation

For comprehensive functional studies of recombinant S. americana innexin inx1, researchers should consider investigating common post-translational modifications such as phosphorylation, glycosylation, and ubiquitination, which may affect channel properties and cellular localization.

How do innexin gene families compare across different invertebrate species?

Comparative genomic analysis reveals interesting patterns in innexin gene family evolution:

SpeciesNumber of Innexin GenesNotable FeaturesReference
Lymnaea stagnalis8 (Lst Inx1-Lst Inx8)Originated from a single copy in common molluskan ancestor
Schistocerca gregaria4 (Sg-inx1, Sg-inx2, Sg-inx3, Sg-inx4)Expressed in frontal ganglion
Scylla paramamosainAt least 2 (Sp-inx2, Sp-inx3)Sp-inx2 involved in immune response and cell apoptosis

Phylogenetic analysis suggests that innexin genes have undergone multiple gene duplication events, followed by functional diversification . For example, in L. stagnalis, the eight innexin genes originated from a single copy in the common ancestor of molluskan species and have been maintained since they were generated . This evolutionary pattern suggests that studying innexin diversity across species can provide insights into the functional specialization of these proteins.

How do functional properties of innexin channels differ between species?

Functional properties of innexin channels can vary significantly between species, reflecting adaptations to different physiological needs. In Schistocerca gregaria, innexins form functional electrical synapses in the frontal ganglion, contributing to rhythm-generating networks important for behavior . In Scylla paramamosain, Sp-inx2 forms hemichannels in crab hemocytes and regulates immune response and cell apoptosis .

These differences highlight the functional versatility of innexin proteins across invertebrate species. Researchers working with recombinant S. americana innexin inx1 should consider these species-specific functional adaptations when designing experiments and interpreting results.

How can structural modeling inform our understanding of innexin channel function?

Structural modeling of innexin channels can provide valuable insights into:

  • Channel architecture: Predicting the arrangement of transmembrane domains and the structure of the pore-forming region.

  • Protein-protein interactions: Identifying residues involved in hemichannel docking and interactions with regulatory proteins.

  • Gating mechanisms: Understanding how voltage, pH, and chemical signals affect channel opening and closing.

  • Species differences: Comparing structural models across species to identify conserved and variable regions that may explain functional differences.

For researchers working with recombinant S. americana innexin inx1, sequence alignment with innexins from related species, followed by homology modeling, can provide a framework for designing structure-function studies and interpreting experimental results.

How do innexins contribute to neural network function and behavior?

Innexins play critical roles in neural network function and behavior in invertebrates. In Schistocerca gregaria, innexins in the frontal ganglion contribute to rhythm-generating networks . Coupling through gap junctions is accepted as a major pathway that supports network behavior and contributes to physiological rhythms . The expression of multiple innexin genes (Sg-inx1, Sg-inx2, Sg-inx3, and Sg-inx4) in the frontal ganglion suggests complex roles in neural communication .

The high expression of Sp-inx3 in the nervous system of Scylla paramamosain, including the eyestalk, brain, and thoracic ganglion mass, further supports the importance of innexins in neural function . Research on innexins in Lymnaea stagnalis has revealed heterogeneity in expression patterns among cells and ganglia, suggesting functional diversification that may relate to cell-specific outputs such as heterogenic ability to form channels and exhibit synapse plasticity .

What are the implications of innexin research for understanding human connexin-related diseases?

Although innexins (invertebrates) and connexins (vertebrates) show low sequence similarity, they form structurally and functionally similar gap junction channels. This evolutionary convergence makes innexin research valuable for understanding human connexin-related diseases. Key implications include:

  • Model systems for disease mechanisms: Invertebrate models expressing recombinant innexins can provide insights into gap junction-related disease mechanisms.

  • Drug discovery: Screening for compounds that modulate innexin channel function may identify leads for developing therapies targeting human connexins.

  • Structural insights: Comparative analysis of innexin and connexin structures can reveal conserved features essential for channel function.

  • Functional redundancy: Understanding how multiple innexin isoforms compensate for each other may inform therapeutic strategies for connexin-related diseases.

How can CRISPR-Cas9 gene editing advance innexin research?

CRISPR-Cas9 gene editing offers powerful approaches for innexin research that complement traditional RNAi methods:

  • Precise gene knockout: Creating complete loss-of-function mutations in innexin genes to study their roles in development and physiology.

  • Knock-in models: Introducing fluorescent tags or epitope tags to study innexin protein localization and dynamics in live cells.

  • Point mutations: Generating specific amino acid changes to study structure-function relationships in innexin channels.

  • Conditional expression: Developing tissue-specific or temporally controlled innexin expression systems to dissect their roles in specific contexts.

While the provided search results don't directly mention CRISPR-Cas9 applications in innexin research, this technology represents an important frontier for advancing our understanding of these critical gap junction proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.