Recombinant Schistocerca americana Innexin inx2 (inx2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its implementation.
Synonyms
inx2; Innexin inx2; Innexin-2; G-Inx2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Schistocerca americana (American grasshopper)
Target Names
inx2
Target Protein Sequence
MFDVFGSVKGLLKLDSVCIDNNLFRLHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP
LAVMDTYCWIYSTFTIPNRLNGKIGLEVAHPGVGAHVAGKDEVKYHKYYQWVCFVLFFQA
ILFYIPRYLWKTWEGGRIKMLVLDLNSPVVNEQSKADRKKLLVDYFATNLHTQNFYAYRF
FICEALNFVNVVGQIYFMDLFLDGEFTTYGSDVVRFTEMEPEERSDPMSRVFPKVTKCTF
HKYGPSGSVQTFDGLCVLPLNIVNEKIYVFLWFWFVILSVLTGIGLVYRLATAMGPQMRM
YLLRARSRLAPQDQIETISNKCQIGDWFVLYQLGKNIDPLIYKELVADLAKKLEGKEIV
Uniprot No.
Target Background
Function
Structural components of the gap junctions.
Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Widespread expression in embryo, in anterior and posterior row of neural precursors, midline precursors and in epithelial sheet of stomodeum.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
