Recombinant Schistocerca gregaria Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Introduction to Cytochrome c Oxidase Subunit 2 (COII)

Cytochrome c oxidase is a crucial enzyme in the electron transport chain of mitochondria, playing a pivotal role in cellular respiration by transferring electrons from cytochrome c to oxygen, thereby generating ATP. The enzyme is composed of multiple subunits, with subunit 2 (COII) being one of the core components. COII is particularly significant because it contains the CuA redox center, which is essential for electron transfer during the oxidative phosphorylation process.

Recombinant Schistocerca gregaria Cytochrome c Oxidase Subunit 2 (COII)

Recombinant Schistocerca gregaria Cytochrome c oxidase subunit 2 (COII) refers to a genetically engineered version of the COII protein derived from the desert locust, Schistocerca gregaria. This recombinant protein is produced using molecular biology techniques, typically involving the expression of the COII gene in a host organism such as Escherichia coli or other suitable expression systems.

Production and Purification

The production of recombinant COII involves several steps:

  • Cloning: The COII gene is isolated from Schistocerca gregaria and cloned into an expression vector.

  • Expression: The vector is introduced into a host organism, where the COII gene is expressed.

  • Purification: The recombinant protein is purified using techniques such as affinity chromatography or gel filtration.

Comparison with Other Organisms

COII from different organisms shows significant homology, reflecting its conserved role across species. For example, the COII from Rhodobacter sphaeroides shows substantial homology to the bovine mitochondrial oxidase, highlighting the evolutionary conservation of this enzyme's structure and function .

OrganismHomology to Bovine COII
Rhodobacter sphaeroides63%
Paracoccus denitrificans68%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Schistocerca gregaria (Desert locust)
Target Names
COII
Target Protein Sequence
MATWSNLSIQDGASPLMEQLSFFHDDHTMVVLLITVIVGYALSYMLFNAYTNRNMLHGHL IETIWTALPAITLIFIALPSLRLLYLLDDSVDAMITIKTIGRQWYWSYEYSDFMDVEFDT YMTPEQDLENDGFRLLDVDNRTILPMNTEVRVLTSASDVLHSWAVPALGVKIDATPGRLN QGTFTMNRPGLFFGQCSEICGANHSFMPIVIESTSVNLFIKWLSKMI
Uniprot No.

Target Background

Function

Recombinant Schistocerca gregaria Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprised of heme A3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 and what role does it play in Schistocerca gregaria biology?

Cytochrome c oxidase subunit 2 (COII) is a critical component of the cytochrome c oxidase complex (COX), which serves as the terminal enzyme in the mitochondrial electron transport chain. In Schistocerca gregaria (desert locust), COII plays an essential role in oxidative phosphorylation (OXPHOS), particularly supporting the enormous energy demands required for flight. The protein consists of 227 amino acids with a specific sequence that contributes to its functional properties in the respiratory chain . COII is encoded in the mitochondrial genome and contributes to the generation of ATP through the process of cellular respiration. The regulation of COII activity directly impacts the locust's energy metabolism, particularly in flight muscles where mitochondrial density is exceptionally high to support the metabolic requirements of sustained flight . Research indicates that COX function is particularly crucial for insect flight biology, with regulatory mechanisms operating at transcriptional, post-translational, and allosteric levels.

How is the structure of Schistocerca gregaria COII characterized and how does it compare to COII from other insect species?

The Schistocerca gregaria COII protein structure features specific domains that facilitate its function within the cytochrome c oxidase complex. The full amino acid sequence (1-227aa) has been determined as: MATWSNLSIQDGASPLMEQLSFFHDDHTMVVLLITVIVGYALSYMLFNAYTNRNMLHGHLIETIWTALPAITLIFIALPSLRLLYLLDDSVDAMITIKTIGRQWYWSYEYSDFMDVEFDTYMTPEQDLENDGFRLLDVDNRTILPMNTEVRVLTSASDVLHSWAVPALGVKIDATPGRLNQGTFTMNRPGLFFGQCSEICGANHSFMPIVIESTSVNLFIKWLSKMI . This sequence contains transmembrane regions that anchor the protein in the inner mitochondrial membrane and specific motifs that enable electron transfer during oxidative phosphorylation. When compared to COII from other insect species, Schistocerca gregaria COII shows high conservation in functionally critical regions while exhibiting specific adaptations that may relate to the desert locust's unique energy requirements. The mitochondrial genome of the related species Chorthippus rosea has been noted to be 21 bp longer than that of Schistocerca gregaria, indicating potential structural variations between related orthopteran species . Researchers typically use comparative sequence analysis and structural modeling to identify conserved domains that maintain core functionality alongside variable regions that may confer species-specific properties.

What expression systems are most effective for producing recombinant Schistocerca gregaria COII for research purposes?

For the expression of recombinant Schistocerca gregaria COII, Escherichia coli has been successfully employed as demonstrated in commercial preparations where the full-length protein (1-227aa) is produced with an N-terminal His-tag . This bacterial expression system offers advantages in terms of scalability, cost-effectiveness, and relatively high protein yields. The successful expression protocol typically involves optimization of codon usage for E. coli, careful temperature control during induction, and selection of appropriate E. coli strains that can accommodate the expression of membrane-associated proteins. Post-expression purification generally employs immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag, followed by additional purification steps as needed to achieve greater than 90% purity as determined by SDS-PAGE . Storage recommendations for the purified protein include lyophilization and reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C to prevent protein degradation and maintain functionality . Alternative expression systems such as insect cell lines might offer advantages for producing COII with more native-like post-translational modifications, though this approach would likely require additional optimization steps.

How does COII function differ between solitarious and gregarious phases of Schistocerca gregaria?

The desert locust Schistocerca gregaria exhibits a fascinating form of phenotypic plasticity known as phase polyphenism, where individuals can develop into two extremely different phenotypes—solitarious and gregarious—depending on population density . Research into the molecular basis of this phase transition has identified potential differences in the expression and regulation of mitochondrial proteins, including COII, between these two phases. Transcriptome analysis of the central nervous system from both solitarious and gregarious locusts has revealed differentially represented transcripts that highlight the involvement of the CNS in the phase transition process . While specific functional differences in COII between the two phases have not been fully characterized, the extensive metabolic and physiological differences between phases suggest potential variations in energy metabolism and mitochondrial function. The gregarious phase, which is associated with increased locomotion and swarming behavior, likely requires enhanced energy production through oxidative phosphorylation, potentially involving upregulation or modified regulation of COII and other components of the electron transport chain. Research methodologies to investigate these differences typically involve comparative transcriptomics, proteomics, and functional enzymatic assays to quantify COX activity in tissues from locusts in different phases.

What are the optimal storage and handling conditions for maintaining the activity of recombinant Schistocerca gregaria COII?

Maintaining the biological activity of recombinant Schistocerca gregaria COII requires careful attention to storage and handling conditions to prevent protein denaturation and loss of function. According to established protocols, the purified recombinant protein is best preserved in a lyophilized powder form prior to use . For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol to a final concentration between 5-50% (with 50% being the default recommendation) . The reconstituted protein should be stored at -20°C to -80°C for long-term preservation, with aliquoting strongly advised to avoid repeated freeze-thaw cycles that can progressively degrade protein structure and function. For short-term usage over the course of a week, working aliquots can be maintained at 4°C . The storage buffer composition significantly impacts stability, with Tris/PBS-based buffer at pH 8.0 containing 6% trehalose demonstrating effectiveness in maintaining protein integrity during storage . For handling during experiments, it is advisable to briefly centrifuge the vial before opening to ensure the contents are at the bottom and to minimize protein exposure to ambient temperature fluctuations, oxidizing conditions, and proteolytic enzymes that could compromise activity.

What methodologies are most effective for studying the post-translational modifications of Schistocerca gregaria COII?

The investigation of post-translational modifications (PTMs) in Schistocerca gregaria COII requires sophisticated analytical approaches that can detect and characterize chemical alterations to the protein structure. Mass spectrometry-based proteomics represents the gold standard methodology, beginning with careful extraction of mitochondrial proteins using buffers that preserve PTMs, followed by enzymatic digestion (typically with trypsin) to generate peptide fragments amenable to MS analysis. Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) enables high-sensitivity detection of modifications such as phosphorylation, acetylation, methylation, and ubiquitination through the identification of characteristic mass shifts in modified peptides compared to their unmodified counterparts. Enrichment strategies such as immobilized metal affinity chromatography (IMAC) for phosphopeptides or immunoprecipitation with modification-specific antibodies can enhance detection sensitivity for low-abundance modifications. Complementary approaches include Western blotting with antibodies specific to particular PTMs, though this requires availability of suitable antibodies for insect COII modifications. Site-directed mutagenesis of recombinant COII can be employed to confirm the functional significance of identified modification sites by replacing modifiable residues and assessing the impact on enzyme activity. Comparative PTM profiling between different physiological states (e.g., resting vs. flying locusts, or solitarious vs. gregarious phases) can provide insights into how post-translational regulation of COII contributes to adaptive changes in energy metabolism under different conditions.

How can researchers effectively measure the kinetic parameters of recombinant Schistocerca gregaria COII and compare them with the native enzyme?

Determining the kinetic parameters of recombinant Schistocerca gregaria COII and comparing them with the native enzyme requires rigorous experimental design and careful consideration of the protein's membrane-associated nature. The first step involves establishing a reliable enzymatic assay, typically based on spectrophotometric monitoring of cytochrome c oxidation at 550 nm, where decreased absorbance correlates with enzyme activity. For accurate kinetic measurements, researchers should prepare the recombinant COII in a lipid environment that mimics the native mitochondrial membrane, such as proteoliposomes or nanodiscs, to maintain proper protein folding and function. Kinetic parameters including Km, Vmax, and kcat should be determined under varying substrate (reduced cytochrome c) concentrations while maintaining optimal pH (typically 7.2-7.4) and temperature (25-30°C for insect enzymes). Multiple experimental replicates (n≥3) are essential for statistical validity, and data should be analyzed using appropriate enzyme kinetics software implementing Michaelis-Menten or allosteric models as appropriate. For comparison with the native enzyme, mitochondrial preparations from Schistocerca gregaria flight muscles should undergo gentle solubilization to extract the cytochrome c oxidase complex while preserving its activity. Side-by-side experiments must be conducted under identical conditions to enable direct comparison of kinetic parameters. Additionally, researchers should assess the effects of known regulators such as ATP/ADP ratio and calcium on both recombinant and native enzyme activities to evaluate whether regulatory mechanisms are preserved in the recombinant protein .

How does the regulation of COII expression and activity contribute to metabolic adaptation in different developmental stages of Schistocerca gregaria?

The regulation of COII expression and activity across different developmental stages of Schistocerca gregaria represents a critical aspect of metabolic adaptation, particularly as the insect transitions between non-flying nymphal stages and the metabolically demanding adult stage capable of sustained flight. Investigating this developmental regulation requires a comprehensive approach combining transcriptomic, proteomic, and functional analyses. Quantitative PCR and RNA-seq can track changes in COII transcript abundance across developmental stages, while Western blotting and targeted proteomics can quantify protein levels and post-translational modifications. Cytochrome c oxidase enzyme activity assays conducted on mitochondria isolated from different developmental stages can reveal functional changes in the enzyme's catalytic properties. The regulatory mechanisms controlling COII expression likely involve both nuclear factors that coordinate mitochondrial biogenesis and mitochondrial-specific regulatory pathways that respond to energy demands . Researchers should investigate how these regulatory networks interact with developmental hormones such as juvenile hormone and ecdysone that orchestrate insect metamorphosis. The phase status (solitarious vs. gregarious) adds another layer of complexity, as these phenotypes show distinct metabolic profiles that may involve differential regulation of COII and other mitochondrial components . Experimental approaches should include comparative analyses between developmental stages within each phase, as well as between phases at equivalent developmental points, to dissect the relative contributions of development and phase to COII regulation. Additionally, manipulating energy demands through controlled exercise protocols or dietary interventions can reveal how COII regulation responds to changing metabolic requirements during development.

What techniques are most effective for assessing the purity and integrity of recombinant Schistocerca gregaria COII preparations?

The assessment of purity and integrity of recombinant Schistocerca gregaria COII preparations requires a combination of biochemical, spectroscopic, and functional analyses to ensure the protein meets research-grade standards. SDS-PAGE represents the foundational technique for purity assessment, with successful preparations typically achieving greater than 90% purity as visualized by Coomassie or silver staining . This electrophoretic analysis should be complemented by Western blotting using antibodies specific to COII or the His-tag to confirm protein identity. Size exclusion chromatography can provide information about the protein's oligomeric state and detect aggregation, while dynamic light scattering offers insights into size distribution and potential aggregation tendencies in solution. Mass spectrometry, particularly intact protein MS, can verify the correct molecular weight and detect any truncations or unexpected modifications. Circular dichroism spectroscopy can assess secondary structure content, providing information about proper protein folding. For functional integrity, enzyme activity assays measuring cytochrome c oxidation rates are essential to confirm that the recombinant protein retains catalytic functionality. Thermal shift assays can evaluate protein stability under different buffer conditions, informing optimal storage parameters. Additionally, researchers should assess the lipid content of preparations, as proper lipid association is often critical for maintaining the structure and function of membrane proteins like COII. These combined approaches provide a comprehensive assessment of both the physical and functional integrity of recombinant COII preparations, ensuring that experimental results obtained using these preparations are reliable and reproducible.

What are the most reliable methods for quantifying the expression levels of COII in different tissues of Schistocerca gregaria?

Quantifying COII expression across different tissues of Schistocerca gregaria requires a combination of transcript and protein-level analyses to provide a comprehensive picture of expression patterns. For transcript quantification, quantitative real-time PCR (qRT-PCR) offers a targeted approach with high sensitivity, requiring careful design of COII-specific primers and selection of appropriate reference genes that show stable expression across the tissues being compared. RNA-sequencing provides a broader perspective, allowing simultaneous analysis of COII expression alongside other mitochondrial and nuclear genes involved in energy metabolism. At the protein level, Western blotting with antibodies specific to Schistocerca gregaria COII or conserved epitopes in insect COII can quantify relative protein abundance, while absolute quantification can be achieved through targeted proteomics approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry using isotopically labeled peptide standards. Immunohistochemistry or immunofluorescence microscopy can visualize the spatial distribution of COII within tissues, providing insights into subcellular localization and potential concentration in specific cell types such as flight muscle fibers. Enzyme activity assays measuring cytochrome c oxidase function in tissue homogenates or isolated mitochondria provide functional correlation with expression data. For comparative tissue analyses, standardization is crucial—researchers should normalize data to tissue weight, protein content, mitochondrial content (using markers such as citrate synthase activity), or cell number depending on the specific research question. Additionally, considering that COII is encoded in the mitochondrial genome, quantification of mitochondrial DNA copy number using qPCR can provide insights into the regulation of COII expression at the genome level.

How can researchers effectively use recombinant COII to develop antibodies for studying native Schistocerca gregaria COII?

Developing specific antibodies against Schistocerca gregaria COII using recombinant protein as an immunogen requires strategic planning and rigorous validation to ensure antibody specificity and utility in various experimental applications. Researchers should begin by identifying immunogenic regions within the COII sequence through in silico analysis using epitope prediction algorithms, focusing on sequences that are surface-exposed yet unique to Schistocerca gregaria COII to minimize cross-reactivity with orthologous proteins from other species. For antibody production, purified recombinant full-length His-tagged COII can serve as the primary immunogen, though for targeting specific domains, synthetic peptides corresponding to selected epitopes conjugated to carrier proteins represent an alternative approach. When immunizing host animals (typically rabbits for polyclonal antibodies or mice for monoclonal antibody development), a prime-boost immunization schedule with appropriate adjuvants should be employed, with serum collection and antibody purification following established protocols. Rigorous validation is essential and should include Western blotting against both recombinant COII and native protein from Schistocerca gregaria mitochondrial preparations, with pre-immune serum as a negative control. Specificity testing should include competitive binding assays and testing against tissues from species with homologous COII to assess potential cross-reactivity. For applications requiring higher specificity, monoclonal antibodies can be developed through hybridoma technology following immunization with the recombinant protein. The validated antibodies can then be employed in multiple applications including Western blotting, immunoprecipitation, immunohistochemistry, and chromatin immunoprecipitation, enabling comprehensive studies of COII expression, localization, and interaction partners in Schistocerca gregaria.

What statistical approaches are most appropriate for analyzing experimental data on Schistocerca gregaria COII activity?

The statistical analysis of Schistocerca gregaria COII activity data requires approaches that can accommodate the hierarchical nature of biological variation and the potential non-normality of enzymatic activity distributions. For comparing COII activity between experimental groups (e.g., solitarious vs. gregarious phases, different tissues, or environmental conditions), researchers should first assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests to determine whether parametric or non-parametric methods are appropriate. For normally distributed data with homogeneous variances, analysis of variance (ANOVA) provides a robust framework for multi-group comparisons, with post-hoc tests such as Tukey's HSD to identify specific group differences while controlling for multiple comparisons. When experimental designs include nested factors (e.g., individuals within phases, tissues within individuals), mixed-effects models offer superior analysis power by partitioning variance components appropriately and accounting for random effects. For kinetic parameter estimation (Km, Vmax), non-linear regression should be employed using models appropriate to the observed kinetic behavior (Michaelis-Menten, Hill equation, etc.), with confidence intervals calculated through bootstrapping or profile likelihood methods rather than relying solely on standard errors. Time-series data from experiments tracking COII activity changes during development or phase transition are best analyzed through repeated measures ANOVA or mixed-effects models with time as a fixed effect. For all analyses, effect sizes (Cohen's d, partial η²) should be reported alongside p-values to indicate biological significance, and power analyses should be conducted a priori to ensure sufficient sample sizes for detecting biologically meaningful effects. All statistical analyses should be implemented in appropriate software such as R, with detailed reporting of statistical methods, assumptions testing, and transformations applied to facilitate reproducibility.

What strategies can researchers use to integrate data on COII structure, function, and regulation to develop comprehensive models of Schistocerca gregaria energy metabolism?

Developing comprehensive models of Schistocerca gregaria energy metabolism that incorporate COII data requires integrative strategies that bridge multiple levels of biological organization, from molecular structure to organismal physiology. Researchers should begin by constructing structural models of Schistocerca gregaria COII using homology modeling based on crystal structures of cytochrome c oxidase from other species, enabling prediction of functional domains, interaction interfaces, and regulatory sites. These structural insights can inform site-directed mutagenesis experiments to validate the functional significance of specific residues and domains. Integration of transcriptomic data on COII and other metabolic genes with proteomic data on enzyme abundance and post-translational modifications can reveal coordinated regulation patterns across the metabolic network . Flux balance analysis and constraint-based modeling approaches can incorporate measured enzymatic parameters to predict metabolic flux distributions under different physiological conditions or between phases. Time-course data tracking changes in COII activity and other metabolic parameters during development or phase transition can be used to construct dynamic models that capture the temporal regulation of energy metabolism. Multi-omics data integration approaches, such as weighted gene correlation network analysis or partial least squares discriminant analysis, can identify modules of co-regulated genes and proteins associated with specific metabolic states. Agent-based modeling can simulate how cellular-level properties scale up to tissue and organismal physiology, particularly in predicting energy allocation during activities such as flight. These computational models should be iteratively refined through experimental validation, with model predictions guiding new experiments and experimental results informing model refinement. The ultimate goal should be a multi-scale model that connects molecular-level properties of COII to the remarkable physiological capabilities of the desert locust, particularly its capacity for sustained flight and phenotypic plasticity in response to environmental conditions .

What emerging technologies hold promise for advancing our understanding of COII function in Schistocerca gregaria?

Several cutting-edge technologies are poised to revolutionize our understanding of COII function in Schistocerca gregaria, enabling unprecedented insights at molecular, cellular, and organismal levels. CRISPR-Cas9 genome editing, while technically challenging in non-model insects, offers transformative potential for creating precise modifications to the mitochondrial COII gene to study structure-function relationships in vivo. Cryo-electron microscopy (cryo-EM) could enable high-resolution structural determination of the complete cytochrome c oxidase complex from Schistocerca gregaria, revealing phase-specific structural adaptations currently inaccessible through homology modeling alone. Single-cell transcriptomics and proteomics can uncover cell-type-specific regulation of COII and other mitochondrial components across tissues, providing insights into the cellular heterogeneity underlying tissue-level energy metabolism. Biological nanopore technology offers innovative approaches for studying single-molecule enzyme kinetics of membrane proteins like COII in lipid environments that closely mimic native mitochondrial membranes. Metabolic flux analysis using stable isotope labeling combined with mass spectrometry can quantify how changes in COII activity impact carbon and energy flux through central metabolic pathways. Optogenetic approaches adapted for controlling mitochondrial function could enable precise temporal manipulation of COII activity in living cells to study downstream metabolic consequences. Advanced imaging techniques such as super-resolution microscopy and correlative light and electron microscopy (CLEM) can visualize COII distribution and dynamics within the mitochondrial ultrastructure at unprecedented resolution. Computational approaches including molecular dynamics simulations spanning microsecond timescales can model electron and proton transfer dynamics through the COII protein, while machine learning algorithms can integrate multi-omics data to identify emergent patterns in COII regulation across developmental stages and environmental conditions.

How might research on Schistocerca gregaria COII contribute to our broader understanding of insect flight energetics and phase polyphenism?

Research on Schistocerca gregaria COII has significant potential to advance our fundamental understanding of both insect flight energetics and the molecular underpinnings of phase polyphenism, with implications extending far beyond this specific species. By elucidating the regulatory mechanisms controlling COII function during flight, researchers can gain insights into how insects achieve the remarkable metabolic rates necessary for powered flight, which represents one of the most energetically demanding activities in the animal kingdom . The desert locust's ability to sustain long-distance migratory flights makes it an exemplary model for studying the upper limits of mitochondrial performance and the molecular adaptations that enable such extreme energy production. The phase polyphenism exhibited by Schistocerca gregaria provides a unique opportunity to study how the same genome can produce dramatically different phenotypes with distinct metabolic profiles, offering insights into epigenetic regulation of mitochondrial function . Comparative studies of COII regulation between solitarious and gregarious phases can reveal how energy metabolism is reprogrammed during phase transition, contributing to our understanding of phenotypic plasticity as an adaptive strategy. From an evolutionary perspective, research on Schistocerca gregaria COII can illuminate how natural selection has shaped mitochondrial function in response to different ecological pressures, particularly in insects with complex life histories and variable environmental conditions. By establishing molecular links between environmental cues, neuroendocrine signaling, and mitochondrial function, this research can provide a mechanistic framework for understanding how ecological factors drive physiological adaptations. Additionally, insights gained from studying COII in this extremophile insect could inform biomimetic approaches to designing highly efficient energy conversion systems or development of targeted control methods for pest locusts that specifically disrupt energy metabolism during critical life stages such as long-distance migration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.