Recombinant Schistocerca gregaria Opsin-1 (Lo1)
Shipped with Ice Packs 
In Stock 
Description
Production and Purification
Recombinant Lo1 is synthesized using heterologous expression systems. Commercial suppliers provide optimized protocols for stability and yield:
Research Applications
Recombinant Lo1 is utilized in diverse studies:
Vision and Neurobiology
-
Polarization Sensitivity: Studies on DRA photoreceptors show Lo1’s role in detecting polarized light patterns for navigation .
-
Circadian Rhythms: Lo1 expression patterns correlate with diurnal activity in gregarious locusts, unlike nocturnal solitarious morphs .
Pest Control
-
Genome sequencing of Schistocerca gregaria (8.8 Gb) identified Lo1 as a target for disrupting swarming behavior via sensory manipulation .
Evolutionary Studies
-
Comparative analyses reveal Lo1’s homology with opsins in other insects, such as Lepidoptera, highlighting conserved light-sensing mechanisms .
Key Research Findings
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lo1; Opsin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Schistocerca gregaria (Desert locust)
Target Names
Lo1
Target Protein Sequence
MASASLISEPSFSAYWGGSGGFANQTVVDKVPPEMLYLVDPHWYQFPPMNPLWHGLLGFV
IGVLGVISVIGNGMVIYIFSTTKSLRTPSNLLVVNLAFSDFLMMFTMSAPMGINCYYETW
VLGPFMCELYALFGSLFGCGSIWTMTMIALDRYNVIVKGLSAKPMTNKTAMLRILFIWAF
SVAWTIMPLFGWNRYVPEGNMTACGTDYLTKDWVSRSYILVYSFFVYLLPLGTIIYSYFF
ILQAVSAHEKQMREQRKKMNVASLRSAEASQTSAECKLAKVALMTISLWFFGWTPYLIIN
FTGIFETMKISPLLTIWGSLFAKANAVFNPIVYGISHPKYRAALEKKFPSLACASSSDDN
TSVASGATTVSDEKSEKSASA
Uniprot No.
Target Background
Function
Visual pigments are light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
