Recombinant Schistocerca gregaria Opsin-2 (Lo2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Schistocerca gregaria Opsin-2 (Lo2) is a full-length, His-tagged protein (UniProt ID: Q26495) derived from the desert locust. It belongs to the opsin family of light-sensitive G-protein-coupled receptors, specifically expressed in photoreceptor cells of the dorsal rim area (DRA) of the compound eye . This protein is essential for understanding polarization vision and spectral adaptation in locusts .

Polarization and Spectral Sensitivity

  • Dorsal Rim Area (DRA) Specificity: Lo2 is exclusively expressed in DRA photoreceptors, which detect polarized light for compass navigation . These receptors exhibit high polarization sensitivity (PS: 1.3–31.7) and peak spectral sensitivity at 441 nm (blue light) .

  • Phase-Specific Adaptations: Gregarious (day-active) and solitarious (night-active) locust morphs show differential Lo2 expression, with solitarious locusts exhibiting spectral shifts for low-light adaptation .

Table 2: Key Research Applications of Recombinant Lo2

ApplicationDescription
Polarization Vision StudiesInvestigating neural mechanisms of sky polarization detection in insects .
Gene Expression ProfilingTranscriptome analyses of locust phase polyphenism and neuronal plasticity .
Antibody ProductionPolyclonal antibodies generated for Western blotting and immunohistochemistry .

Future Directions

Current research leverages recombinant Lo2 to explore:

  • Neuronal Signaling Pathways: Interactions with retinoid X receptors (RXRs) and chemoreception proteins .

  • Evolutionary Adaptations: Comparative studies with orthopteran species to unravel spectral tuning mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lo2; Opsin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Schistocerca gregaria (Desert locust)
Target Names
Lo2
Target Protein Sequence
MVNTTDFYPVPAAMAYESSVGLPLLGWNVPTEHLDLVHPHWRSFQVPNKYWHFGLAFVYF MLMCMSSLGNGIVLWIYATTKSIRTPSNMFIVNLALFDVLMLLEMPMLVVSSLFYQRPVG WELGCDIYAALGSVAGIGSAINNAAIAFDRYRTISCPIDGRLTQGQVLALIAGTWVWTLP FTLMPLLRIWSRFTAEGFLTTCSFDYLTDDEDTKVFVGCIFAWSYAFPLCLICCFYYRLI GAVREHEKMLRDQAKKMNVKSLQSNADTEAQSAEIRIAKVALTIFFLFLCSWTPYAVVAM IGAFGNRAALTPLSTMIPAVTAKIVSCIDPWVYAINHPRFRAEVQKRMKWLHLGEDARSS KSDTSSTATDRTVGNVSASA
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They are composed of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Schistocerca gregaria Opsin-2 (Lo2) and what is its significance in research?

Recombinant Schistocerca gregaria Opsin-2 (Lo2) is a protein derived from the desert locust (Schistocerca gregaria) that functions as a transmembrane protein involved in the visual system of these insects . The protein is identified in the UniProt database with the accession number Q26495, confirming its status as a characterized protein with documented properties . Opsins represent a crucial family of G protein-coupled receptors that are essential for photoreception in insects and other organisms, making them valuable targets for studying fundamental aspects of vision, signal transduction, and sensory biology. The recombinant form of this protein provides researchers with a standardized and purified preparation that enables consistent experimental approaches to investigating its properties and functions.

The significance of studying Opsin-2 from Schistocerca gregaria extends beyond understanding basic insect biology. Research on locust opsins contributes to broader comparative studies of visual systems across evolutionary lineages, potentially revealing conserved mechanisms and adaptive specializations. Additionally, since desert locusts undergo dramatic phase transitions (solitary to gregarious) that include changes in visual processing, understanding the molecular components of their visual system may provide insights into how environmental factors influence sensory processing and subsequent behavior. The availability of recombinant Opsin-2 enables researchers to conduct controlled in vitro experiments that would otherwise be difficult to perform with native protein isolated directly from locust tissue.

What is the amino acid sequence of Schistocerca gregaria Opsin-2 (Lo2) and what structural features does it possess?

The complete amino acid sequence of Schistocerca gregaria Opsin-2 consists of 380 amino acids with several characteristic features typical of opsin proteins . The sequence is: "MVNTTDFYPVPAAMAYESSVGLPLLGWNVPTEHLDLVHPHWRSFQVPNKYWHFGLAFVYF mLMCMSSLGNGIVLWIYATTKSIRTPSNMFIVNLALFDVLmLLEMPmLVVSSLFYQRPVG WELGCDIYAALGSVAGIGSAINNAAIAFDRYRTISCPIDGRLTQGQVLALIAGTWVWTLP FTLMPLLRIWSRFTAEGFLTTCSFDYLTDDEDTKVFVGCIFAWSYAFPLCLICCFYYRLI GAVREHEKmLRDQAKKMNVKSLQSNADTEAQSAEIRIAKVALTIFFLFLCSWTPYAVVAM IGAFGNRAALTPLSTMIPAVTAKIVSCIDPWVYAINHPRFRAEVQKRMKWLHLGEDARSS KSDTSSTATDRTVGNVSASA" . This sequence reveals the expected structural features of a seven-transmembrane domain protein characteristic of G protein-coupled receptors, with hydrophobic regions that anchor the protein within the membrane and intervening hydrophilic loops that extend into either the cytoplasmic or extracellular spaces.

Analysis of the sequence shows conserved motifs that are crucial for opsin function, including residues involved in chromophore binding and G protein interaction. The protein is expressed as a full-length protein covering the region 1-380 of the native sequence . When comparing with other insect opsins, multiple sequence alignment would likely reveal conserved regions across species, particularly in the transmembrane domains and retinal-binding pocket. Structural prediction models based on this sequence would suggest the characteristic seven-transmembrane helical bundle with intracellular and extracellular loops connecting these helices, similar to what has been observed in other resolved opsin structures. The structural features directly influence the protein's ability to capture photons through a bound chromophore and initiate the visual transduction cascade essential for the locust's visual perception.

How should Recombinant Schistocerca gregaria Opsin-2 (Lo2) be stored and handled for optimal experimental results?

Proper storage and handling of Recombinant Schistocerca gregaria Opsin-2 (Lo2) are critical factors for maintaining protein integrity and ensuring reproducible experimental outcomes. According to product information, the recommended storage condition is at -20°C for standard storage periods, while extended storage should be at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to maintain stability during storage . The glycerol component serves as a cryoprotectant, preventing ice crystal formation that could otherwise damage protein structure during freeze-thaw cycles.

To minimize degradation, repeated freezing and thawing cycles should be avoided as these can dramatically reduce protein activity and integrity . A best practice approach is to prepare small working aliquots upon first thawing the stock and to store these aliquots at 4°C if they will be used within one week . For experiments requiring longer-term storage of working solutions, maintaining aliquots at -20°C is advisable. When handling the protein for experiments, researchers should consider the transmembrane nature of Opsin-2, which may require the presence of detergents or lipid environments to maintain proper folding and functionality. Since opsins are light-sensitive proteins, it would be prudent to handle samples under reduced light conditions, particularly when investigating functional aspects related to photoreception. These storage and handling practices are critical for preserving protein structure and function, especially for transmembrane proteins like opsins which are often more susceptible to denaturation compared to soluble proteins.

What methods can be used to investigate the binding properties of Schistocerca gregaria Opsin-2 (Lo2)?

Investigating the binding properties of Schistocerca gregaria Opsin-2 requires specialized techniques that accommodate both its transmembrane nature and its function as a photoreceptor protein. Drawing from methodologies used with related proteins, one approach would involve ligand binding assays using tritium-labeled retinoids similar to those employed for locust RXR proteins . In such assays, purified recombinant Opsin-2 would be incubated with labeled potential ligands, followed by separation of bound from free ligand using hydroxylapatite (HAP) as demonstrated for locust retinoid X receptors . This method would allow for the determination of binding constants and competition profiles with various potential chromophores or signal molecules.

For more detailed binding characterization, saturation binding experiments could be conducted with increasing concentrations of labeled ligand in the presence and absence of excess unlabeled competitor, enabling Scatchard analysis to determine binding affinities and potential binding site numbers . The binding data could be analyzed using graphical software to calculate binding constants (Kd) and half-maximal inhibitory concentrations (IC50) for various ligands . Advanced spectroscopic techniques would also be valuable for studying Opsin-2 binding properties. Absorbance spectroscopy can track wavelength shifts that occur upon chromophore binding and activation, providing insights into the protein's spectral sensitivity. Circular dichroism could monitor conformational changes associated with ligand binding, while fluorescence spectroscopy might detect subtle changes in protein structure upon interaction with various compounds.

Additionally, more sophisticated approaches like isothermal titration calorimetry (ITC) could provide thermodynamic parameters of binding interactions. For understanding the structural basis of ligand interactions, computational methods including molecular docking and molecular dynamics simulations could be employed, based on homology models of Opsin-2 structure derived from the known amino acid sequence . These various methodological approaches would collectively provide a comprehensive understanding of the binding properties and potential ligand specificity of Schistocerca gregaria Opsin-2, contributing to our knowledge of insect visual systems at the molecular level.

How does Schistocerca gregaria Opsin-2 (Lo2) compare functionally to opsins in other insect species?

Comparative analysis of Schistocerca gregaria Opsin-2 (Lo2) with opsins from other insect species provides valuable insights into the evolution and functional diversification of visual systems across the insect lineage. While the search results don't provide direct comparative data, methodological approaches to such comparison would involve multiple sequence alignment of the complete 380-amino acid sequence of S. gregaria Opsin-2 with homologous proteins from other insects. Phylogenetic analysis based on these alignments would reveal evolutionary relationships and potential functional clustering of insect opsins, helping to place Lo2 within the broader context of insect visual evolution.

Functional comparison would extend beyond sequence analysis to include spectral sensitivity characteristics, as different insect opsins are tuned to different wavelengths of light. Heterologous expression systems could be employed to express S. gregaria Opsin-2 alongside opsins from other insects, allowing direct comparison of their spectral absorption profiles and response dynamics. Similar experimental approaches to those used in studying locust retinoid receptors, such as ligand binding assays with labeled retinoids , could be adapted to compare binding properties across different insect opsins. Differences in post-translational modifications, subcellular localization patterns, and interaction partners might also contribute to functional diversity among insect opsins and could be systematically investigated.

The research approaches used to study mitochondrial genes in S. gregaria, which involved careful selection of genomic regions to avoid nuclear pseudogenes , illustrate the methodological rigor needed when comparing genes across species. Similar attention to potential confounding factors would be necessary when comparing opsins across insects, especially given the common occurrence of gene duplication in opsin evolution. The polymorphisms observed in other locust proteins, such as the pigment-dispersing factor , suggest that genetic variation might also be present in opsin genes within and between populations, adding another layer of complexity to comparative analyses. Understanding these functional differences would contribute significantly to our knowledge of how visual systems adapt to diverse ecological niches and environmental challenges across the insect world.

What experimental approaches can be used to study the role of Opsin-2 in locust vision and photoreception?

Investigating the role of Opsin-2 in locust vision and photoreception requires a multi-faceted experimental approach that integrates molecular, cellular, and physiological techniques. Immunohistochemistry using antibodies raised against the purified recombinant Opsin-2 protein would allow precise localization of this protein within the locust visual system, revealing which specific photoreceptor cells express this opsin variant. This approach would be similar to techniques used for detecting retinoid X receptors in locust tissues, where polyclonal antibodies against purified protein were developed for immunological detection . Western blotting with these antibodies could further confirm the presence and molecular weight of Opsin-2 in tissue extracts from different parts of the locust visual system.

Heterologous expression systems, where Opsin-2 is expressed in cultured cells or model organisms, provide another powerful approach for functional characterization. Similar to reporter cell systems used to detect retinoids in locust embryos , engineered cell lines expressing Opsin-2 could be developed to study its activation by different wavelengths of light. Optical imaging techniques using calcium indicators or voltage-sensitive dyes could visualize the response of these cells to light stimulation in real-time. Additionally, in vitro reconstitution of Opsin-2 with various retinal chromophores would allow detailed spectroscopic analysis of absorption properties and conformational changes upon light activation. These diverse experimental approaches would collectively elucidate the specific contribution of Opsin-2 to the desert locust's visual capabilities, potentially revealing adaptations suited to its particular ecological niche.

How can potential polymorphisms in Schistocerca gregaria Opsin-2 be identified and what might be their functional significance?

Identifying polymorphisms in Schistocerca gregaria Opsin-2 requires a comprehensive sampling and sequencing approach across diverse populations. The methodology would parallel approaches used in studies of other locust genes, where researchers sequenced multiple strains to identify polymorphic positions . For Opsin-2, this would involve PCR amplification of the gene from genomic DNA extracted from locusts collected from different geographical regions, followed by Sanger sequencing or next-generation sequencing to identify variations in the nucleotide sequence. Careful primer design would be essential to ensure specific amplification of Opsin-2 without inadvertently amplifying related opsin genes or pseudogenes, similar to the precautions taken when sequencing mitochondrial genes from S. gregaria .

Once polymorphic sites are identified, cloning and sequencing of individual alleles would be necessary to determine their chromosomal linkage, as was done for other locust genes where researchers found that specific allelic variants resided on the same chromosome . Computational analysis of these sequence variations would reveal whether the polymorphisms result in amino acid substitutions (non-synonymous) or silent mutations (synonymous), with non-synonymous changes being of particular interest for their potential functional consequences. Protein structure prediction algorithms could then be applied to model how these amino acid substitutions might affect the three-dimensional structure of Opsin-2, with special attention to variations occurring in transmembrane domains or chromophore-binding regions that could directly impact protein function.

The functional significance of identified polymorphisms could be assessed through heterologous expression of different Opsin-2 variants, followed by detailed characterization of their spectral sensitivity, activation kinetics, and signal transduction properties. Electrophysiological recordings from photoreceptors of locusts with different Opsin-2 genotypes would provide in vivo functional data to complement the in vitro findings. Population genetic analyses examining the frequency and distribution of different Opsin-2 alleles could reveal signatures of selection, potentially linking specific variants to adaptation to different light environments or other ecological factors. Such studies could ultimately provide insights into how visual system diversity at the molecular level contributes to the remarkable adaptability of desert locusts across their wide geographical range and variable habitats.

How can Recombinant Schistocerca gregaria Opsin-2 be utilized in comparative studies of insect visual evolution?

Recombinant Schistocerca gregaria Opsin-2 serves as a valuable molecular tool for comparative studies exploring the evolution of visual systems across insect lineages. Researchers can utilize the purified protein and its known amino acid sequence as a reference point for phylogenetic analyses that reconstruct the evolutionary history of opsin diversification in insects. Such comparative studies would involve sequence alignment of S. gregaria Opsin-2 with homologous proteins from diverse insect orders, ranging from primitive to advanced groups, to trace the patterns of conservation and divergence in key functional domains. These analyses could reveal how selection pressures have shaped the molecular properties of visual pigments across different ecological niches and lifestyles, potentially identifying signatures of adaptive evolution in specific lineages.

Experimental approaches might include reconstitution studies where Opsin-2 from S. gregaria is compared with opsins from other insects in standardized membrane environments, allowing direct comparison of their spectral tuning properties and activation dynamics. The methodologies developed for studying locust retinoid X receptors, such as radio-labeled ligand binding assays , could be adapted for comparative analysis of chromophore binding properties across diverse insect opsins. Structure-function analysis would be particularly informative, comparing how specific amino acid substitutions in homologous positions affect spectral sensitivity between species, potentially revealing the molecular basis for adaptation to different light environments.

Combining molecular and physiological data with information about each species' ecology and behavior would provide a comprehensive framework for understanding how visual system evolution at the molecular level correlates with ecological specialization. For desert locusts specifically, their capacity for extreme phenotypic plasticity (transitioning between solitary and gregarious phases) raises intriguing questions about whether opsin expression or function might also show plasticity under different environmental conditions. Recombinant Opsin-2 could be used to develop specific molecular probes for tracking such changes, potentially revealing novel mechanisms of sensory system adaptation. These comparative approaches would contribute significantly to our understanding of how molecular evolution shapes sensory capabilities across the remarkably diverse insect lineage.

What are the emerging technologies that could advance research on Schistocerca gregaria Opsin-2?

Emerging technologies across various fields present exciting opportunities to deepen our understanding of Schistocerca gregaria Opsin-2 structure, function, and biology. Advanced structural biology techniques, including cryo-electron microscopy and X-ray free-electron laser crystallography, could potentially overcome the historical challenges of determining membrane protein structures, providing unprecedented atomic-level details of Opsin-2 in different conformational states. These structural insights would complement the known amino acid sequence and greatly enhance our understanding of how the protein interacts with chromophores and downstream signaling partners. Single-molecule fluorescence techniques could reveal the conformational dynamics of Opsin-2 during photoactivation in real-time, capturing transient states that are inaccessible to traditional structural methods.

CRISPR-Cas9 genome editing, which has revolutionized genetic manipulation across model and non-model organisms alike, offers powerful new approaches for studying Opsin-2 function in vivo. Researchers could generate locusts with specific modifications to Opsin-2, including complete knockouts, point mutations mimicking naturally occurring polymorphisms similar to those observed in other locust proteins , or fluorescent protein tags for live imaging. Such genetic manipulations would enable precise dissection of Opsin-2's contribution to visual function and related behaviors. Optogenetic techniques, where engineered light-sensitive proteins control neural activity, could be combined with Opsin-2 studies to manipulate and record from photoreceptor circuits, revealing how the visual information captured by Opsin-2 is processed and integrated at the neural level.

Mass spectrometry-based proteomics offers another frontier, potentially identifying Opsin-2 interaction partners and post-translational modifications that regulate its function. Similar to the sensitive detection methods used to identify retinoids in locust embryos , advanced metabolomic approaches could characterize the chromophore composition in locust photoreceptors under different developmental stages or environmental conditions. Integrating these molecular data with whole-organism approaches through the emerging field of phenomics would connect Opsin-2 molecular properties to higher-level visual function and behavior. Machine learning and artificial intelligence approaches could further accelerate discovery by analyzing complex datasets spanning from the molecular to the behavioral level, potentially revealing patterns and relationships not evident through traditional analysis methods. These technological frontiers collectively promise to transform our understanding of insect visual systems and the molecular mechanisms underlying visual perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.