Recombinant Schistosoma japonicum 25 kDa integral membrane protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Schistosomiasis

Sj25 is expressed in multiple life stages of S. japonicum, including miracidia and adults, and localizes to the tegument and subtegumental layers . Its roles include:

  • Host Immune Evasion: Tegumental proteins like Sj25 mediate interactions with host cells, potentially modulating immune responses .

  • Developmental Regulation: Knockdown studies of related annexins (e.g., SjANX A13) suggest tegument proteins influence parasite maturation and egg production .

Research Findings in Vaccine Development

Sj25 has been investigated as a vaccine candidate due to its surface exposure and antigenicity:

Table 2: Key Preclinical Studies

Study ModelFindingsEfficacy (% Reduction)Source
MiceRecombinant Sj25 induced IgG antibodies; partial protection observed.33.5% (worms), 47.6% (eggs)
SheepAdjuvant-free Sj14 (homolog) vaccination achieved 59.2% worm reduction.59.2%
Exosome StudiesSj25 homologs in exosomes implicated in host cell modulation.N/A

Notably, Sj25’s inclusion in DNA vaccines enhanced Th1 responses when combined with cytokines like IL-12 .

Applications in Vaccine Development

  • Antigen Production: Recombinant Sj25 is produced in scalable systems (e.g., E. coli) for antibody generation and epitope mapping .

  • Multi-Antigen Formulations: Combined with antigens like Sj23 or SjFABP, Sj25 improves protective efficacy in preclinical trials .

Challenges:

  • Adjuvant Dependency: Optimal immunity requires adjuvants or delivery systems (e.g., DNA vectors) .

  • Species-Specific Variability: Antibody responses vary between hosts, necessitating tailored formulations .

Future Directions

Ongoing research focuses on:

  • Mechanistic Studies: Elucidating Sj25’s role in exosome-mediated host interactions .

  • Clinical Translation: Optimizing delivery platforms (e.g., nanoparticle carriers) to enhance immunogenicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
25 kDa integral membrane protein; Sj25; Sj25/TM4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Schistosoma japonicum (Blood fluke)
Target Protein Sequence
MKLSFTKVSLTNILILFNCLFIIFSMIVLTFGVIPQIYLLKFANILHGVRPSIFPIVCFT GSFVIIVACVGIIGLMKGGKCLLTMHIIALIIATIIDISTATLSAIKQNEFLTKAGQVLN DSSKLYYKNRLYATEFDLMHITFKCCNVKNDYSLLGTLHLIPESCTHGIEFYKQQCNEPL NKYVRYYIDILIYLCFIFGFIKLIYSLFTFTQRQRIFSEKTPVA
Uniprot No.

Target Background

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of the Schistosoma japonicum 25 kDa integral membrane protein?

The Schistosoma japonicum 25 kDa integral membrane protein is a 224 amino acid protein (full length spanning residues 1-224) that functions as an integral membrane component in the parasite tegument . The protein can be successfully expressed in prokaryotic systems, with E. coli being the most commonly used host for recombinant production .

When expressing this protein recombinantly, researchers typically use a His-tag to facilitate purification, which results in a fusion protein that can be isolated using Ni-NTA agarose chromatography . SDS-PAGE analysis of the purified recombinant protein typically shows a band corresponding to the expected molecular weight of approximately 25 kDa plus the weight of any fusion tags .

The protein's membrane integration suggests it contains hydrophobic domains, making it challenging to express and purify while maintaining native conformation. When designing expression constructs, researchers should consider codon optimization for the expression host and the potential need for detergents during purification to maintain solubility.

How is the Schistosoma japonicum 25 kDa integral membrane protein expressed across different life stages of the parasite?

The 25 kDa integral membrane protein shows stage-specific expression patterns, with higher expression levels generally observed in adult stages of S. japonicum. This protein is notably expressed in the tegument of the parasite, which is the syncytial outer layer that interfaces directly with the host environment .

Research has identified this protein as an orthologue in the S. japonicum tegument, suggesting its importance in host-parasite interactions . When studying stage-specific expression, quantitative real-time PCR (qRT-PCR) is the method of choice, allowing researchers to analyze relative mRNA expression levels across eggs, cercariae, and parasites collected at various days post-infection (dpi).

For experimental design, researchers should:

  • Collect parasites at multiple developmental stages (eggs, cercariae, and adults at 7, 14, 21, and 28 dpi)

  • Extract total RNA using standard protocols

  • Perform reverse transcription to generate cDNA

  • Design specific primers for the 25 kDa integral membrane protein gene

  • Normalize expression using validated housekeeping genes

  • Calculate relative expression using the 2^-ΔCt method

What are the standard methods for detecting Schistosoma japonicum 25 kDa integral membrane protein in experimental samples?

Several methods have been standardized for detecting the S. japonicum 25 kDa integral membrane protein, with ELISA and Western blot being the most commonly employed techniques:

ELISA Protocol:

  • Coat microplate wells with purified recombinant protein (optimize concentration between 2-6 μg/mL)

  • Block non-specific binding sites with PBS containing 0.1% Tween-20 (PBST) and 5% non-fat dry milk

  • Add serum samples at optimized dilutions (typically 1:100 to 1:800)

  • Incubate with appropriate HRP-conjugated secondary antibody (optimize dilution between 1:2500 to 1:20000)

  • Develop with substrate solution (optimize reaction time between 5-20 minutes)

  • Measure absorbance at 450 nm

Western Blot Protocol:

  • Separate proteins using 12% SDS-PAGE under reducing conditions

  • Transfer to PVDF membrane

  • Block with PBST containing 5% non-fat dry milk

  • Incubate with primary antibody (infected sera at 1:200 dilution)

  • Wash with PBST

  • Incubate with HRP-conjugated secondary antibody (1:5000 dilution)

  • Develop using chemiluminescent substrate

  • Detect immunoreactive bands using an imaging system

These methods can be used for various applications including protein detection in parasite extracts, evaluation of recombinant protein quality, and assessment of immunoreactivity with infected host sera.

What is the gene expression profile of the 25 kDa integral membrane protein compared to other Schistosoma proteins?

Meta-analysis of RNA-seq data across Schistosoma life stages provides insights into the relative expression levels of the 25 kDa integral membrane protein. When compared to other Schistosoma proteins, the expression pattern reveals its importance in specific stages of the parasite life cycle.

Gene IDFold difference to other stagesProduct descriptionExpression location
25 kDa integral membrane protein1,584.725 kDa integral membrane proteinOrthologue in S. japonicum tegument
Smp_1949801,478.625 kDa integral membrane proteinSchistosomulum
Smp_1951901,305.213 kDa tegumental antigen Sm13Adult tegument
Smp_131110122,294.5hypothetical protein (Sm_p14)Female vitellarium
Smp_19191049,667.0Stress protein DDR48Male oesophagus; Female

The table shows that while the 25 kDa integral membrane protein has significant stage-specific expression (1,584.7-fold difference), other proteins like Sm_p14 demonstrate even more dramatic stage-specificity (122,294.5-fold difference) . This comparative analysis helps researchers understand the relative importance of the 25 kDa protein within the context of the parasite's proteome.

How can recombinant Schistosoma japonicum 25 kDa integral membrane protein be optimized for diagnostic applications?

Optimizing recombinant S. japonicum 25 kDa integral membrane protein for diagnostic applications requires systematic assessment of multiple parameters:

Optimization of Expression System:

  • Compare prokaryotic (E. coli) vs. eukaryotic expression systems

  • Evaluate different fusion tags (His, GST, MBP) for improved solubility and antigenicity

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

ELISA Parameter Optimization:
Based on experimental data, researchers should systematically evaluate:

ParameterTested RangeOptimal Condition
Coating concentration2, 4, 6 μg/mLDetermined experimentally
Serum dilution1:100, 1:200, 1:400, 1:800Determined experimentally
Secondary antibody dilution1:2500, 1:5000, 1:10000, 1:20000Determined experimentally
Substrate reaction time5, 10, 15, 20 minDetermined experimentally

Evaluation of Diagnostic Performance:

  • Determine sensitivity and specificity using receiver operating characteristic (ROC) analysis

  • Calculate area under curve (AUC) values to compare with other diagnostic antigens

  • Evaluate cross-reactivity with other helminth infections

  • Assess time course of antibody detection at different infection time points (5, 10, 22, and 28 days post-infection)

Diagnostic optimization studies have demonstrated that coating concentration and serum dilution significantly impact assay performance. Testing different parasite burdens (10, 20, 200 cercariae) can help establish the detection limit of the assay for early diagnosis.

What are the comparative advantages of using Schistosoma japonicum 25 kDa integral membrane protein versus other biomarkers for schistosomiasis detection?

Research comparing the S. japonicum 25 kDa integral membrane protein with other biomarkers provides valuable insights for diagnostic development:

Comparative Diagnostic Performance:

ProteinArea Under Curve (AUC)Early Detection CapabilitySensitivity at 28 dpi
25 kDa integral membrane proteinHigh (similar to protein mixture)GoodExcellent
SJHYPLower than 25 kDa proteinLimitedGood
SJCHGC02838Lower than 25 kDa proteinLimitedGood
SJCHGC05593Lower than 25 kDa proteinLimitedGood
SJCHGC05668Highest (close to protein mixture)ExcellentExcellent
Equal mixture of four proteinsHighestExcellentExcellent

Research has demonstrated that SJCHGC05668 protein and the 25 kDa integral membrane protein show particularly high diagnostic potential compared to other biomarkers. SJCHGC05668 is especially valuable for early-stage detection of infection .

Methodological Advantages:

  • The 25 kDa integral membrane protein offers relatively high expression levels in recombinant systems

  • Its presence in the tegument makes it accessible to immune recognition

  • The protein shows consistent recognition by infected sera across different infection intensities

  • It demonstrates less cross-reactivity with antibodies against other parasites compared to some alternatives

When developing diagnostic tests, researchers should consider using a combination approach, potentially including the 25 kDa integral membrane protein alongside SJCHGC05668 for optimal sensitivity and specificity.

What experimental approaches can resolve challenges in expressing full-length recombinant Schistosoma japonicum 25 kDa integral membrane protein?

Expressing integral membrane proteins presents several challenges. Researchers working with the S. japonicum 25 kDa integral membrane protein can implement these methodological approaches:

Expression System Optimization:

  • Consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

  • Evaluate lower induction temperatures (16-20°C) to slow protein synthesis and improve folding

  • Test auto-induction media to provide gradual protein expression

Solubility Enhancement Strategies:

  • Express protein with solubility-enhancing fusion partners (MBP, SUMO, TrxA)

  • Include mild detergents during lysis and purification (e.g., n-dodecyl-β-D-maltoside, CHAPS)

  • Consider removing highly hydrophobic regions while maintaining antigenic epitopes

Purification Optimization:

  • Implement two-step purification using affinity chromatography followed by size exclusion

  • Include glycerol (5-10%) in all buffers to stabilize the protein

  • Test various detergent concentrations above their critical micelle concentration

Refolding Approaches:
If inclusion bodies form despite optimization:

  • Solubilize inclusion bodies with strong denaturants (8M urea or 6M guanidine HCl)

  • Perform step-wise dialysis with decreasing denaturant concentration

  • Include L-arginine (0.4-0.8M) during refolding to prevent aggregation

The successful expression of the 25 kDa integral membrane protein has been reported , indicating that E. coli can produce usable quantities with careful optimization. SDS-PAGE analysis has confirmed protein purity and the expected molecular weight following His-tag purification.

How does the Schistosoma japonicum 25 kDa integral membrane protein interact with the host immune system?

The interaction between the S. japonicum 25 kDa integral membrane protein and the host immune system is complex and can be analyzed through several experimental approaches:

Antibody Response Analysis:

  • ELISA studies using sera from infected mice show progressive increases in antibody responses against the recombinant 25 kDa protein, with detectable levels from 5 days post-infection (dpi) and significantly higher levels at later timepoints (10, 22, and 28 dpi)

  • Western blot analyses confirm specific recognition of the recombinant protein by antibodies from infected hosts

  • Time-course studies demonstrate that antibody responses develop relatively early in infection

Comparative Immunogenicity:
Research indicates the 25 kDa integral membrane protein generates robust immune responses, though specific studies comparing its immunogenicity to other S. japonicum antigens show that SJCHGC05668 and protein mixtures may elicit stronger responses .

Host Immune Response Characterization:
Researchers can characterize the type of immune response by:

  • Analyzing antibody isotypes (IgG1, IgG2a, IgG2b, IgG3, IgM, IgA, IgE) in ELISA

  • Performing cytokine profiling of stimulated peripheral blood mononuclear cells

  • Evaluating T cell responses (Th1/Th2/Th17/Treg) following antigen stimulation

Epitope Mapping:
To identify immunodominant regions:

  • Generate peptide arrays covering the entire protein sequence

  • Test reactivity with sera from infected hosts

  • Identify conserved vs. variable epitopes by comparison with orthologues

Understanding these immune interactions is crucial for evaluating the protein's potential as a diagnostic marker and possible vaccine candidate.

What are the most effective experimental designs for studying the role of Schistosoma japonicum 25 kDa integral membrane protein in parasite-host interactions?

To effectively study the role of the 25 kDa integral membrane protein in parasite-host interactions, researchers should consider these experimental approaches:

In vitro Functional Studies:

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with potential host binding partners

    • Yeast two-hybrid screening using the protein as bait

    • Surface plasmon resonance to measure binding kinetics with host molecules

  • Cell Culture Models:

    • Evaluate protein effects on host cell signaling pathways

    • Measure cytokine production by immune cells exposed to the protein

    • Assess changes in host cell gene expression profiles

In vivo Models:

  • Mouse Infection Models:

    • Infect mice with different cercariae numbers (10, 20, 200) to study dose-dependent effects

    • Collect samples at multiple timepoints (5, 10, 22, 28 dpi) to track temporal changes

    • Compare responses in different mouse strains to identify host genetic factors

  • Immunization Studies:

    • Vaccinate mice with recombinant 25 kDa protein before challenge

    • Measure protection levels and immune correlates

    • Compare with other antigens and combination approaches

Molecular Techniques:

  • Gene Knockdown/Knockout:

    • Use RNA interference to suppress gene expression

    • Assess effects on parasite survival, development, and host interaction

    • Measure changes in tegument structure and function

  • Localization Studies:

    • Perform immunohistochemistry to precisely localize the protein within parasite tissues

    • Use immuno-electron microscopy for ultrastructural localization

    • Track protein distribution across developmental stages

Each experimental approach should include appropriate controls and optimization of parameters for robust, reproducible results.

How can high-throughput screening approaches identify potential inhibitors of the Schistosoma japonicum 25 kDa integral membrane protein?

High-throughput screening (HTS) for inhibitors of the S. japonicum 25 kDa integral membrane protein requires specialized methodologies:

Assay Development:

  • Functional Assays:

    • Develop biochemical assays measuring protein activity (if enzymatic function exists)

    • Create binding displacement assays using labeled ligands

    • Design cell-based assays monitoring protein function in heterologous expression systems

  • Binding Assays:

    • Use surface plasmon resonance with immobilized protein

    • Implement thermal shift assays to identify stabilizing compounds

    • Develop fluorescence polarization assays with labeled peptides/ligands

Compound Library Selection:

  • Select diverse chemical libraries (natural products, FDA-approved drugs, focused libraries)

  • Consider in silico pre-screening based on structural predictions

  • Include known membrane protein inhibitors as positive controls

Screening Workflow:

  • Primary screen at single concentration (10-20 μM)

  • Confirm hits with dose-response curves (IC50 determination)

  • Counter-screen against related proteins to assess selectivity

  • Evaluate cytotoxicity against mammalian cells

Validation Studies:

  • Test effects on parasite survival in vitro

  • Evaluate compound efficacy in animal models

  • Determine mechanism of action through biochemical and structural studies

This systematic approach can identify compounds that specifically interact with the 25 kDa integral membrane protein, potentially leading to novel therapeutic strategies against schistosomiasis.

What is the potential of the Schistosoma japonicum 25 kDa integral membrane protein as a vaccine candidate?

Evaluating the 25 kDa integral membrane protein as a vaccine candidate requires systematic assessment:

Preclinical Vaccine Development Pipeline:

  • Antigen Optimization:

    • Express protein in various systems (E. coli, yeast, mammalian cells)

    • Test different constructs (full-length vs. immunodominant epitopes)

    • Evaluate various formulations (recombinant protein, DNA vaccine, viral vectors)

  • Adjuvant Selection:

    • Compare traditional adjuvants (alum, Freund's) with newer formulations (CpG, QS-21, liposomes)

    • Assess impact on Th1/Th2/Th17 balance

    • Evaluate local and systemic reactogenicity

  • Immunization Protocols:

    • Test prime-boost strategies

    • Determine optimal dose and schedule

    • Evaluate different routes of administration

  • Efficacy Evaluation:

    • Challenge studies measuring worm burden reduction

    • Assessment of egg reduction (fecundity effect)

    • Histopathological examination of target tissues

  • Immune Correlates Analysis:

    • Antibody titers and isotype profiles

    • T cell responses (proliferation, cytokine production)

    • Memory B and T cell generation

How can contradictory research findings about the Schistosoma japonicum 25 kDa integral membrane protein be reconciled through meta-analysis?

When facing contradictory research findings regarding the S. japonicum 25 kDa integral membrane protein, meta-analytical approaches can help reconcile discrepancies:

Systematic Review Methodology:

  • Comprehensive Literature Search:

    • Search multiple databases (PubMed, Web of Science, Scopus)

    • Include preprints and conference proceedings

    • Consider non-English literature and unpublished data

  • Quality Assessment:

    • Evaluate experimental design rigor

    • Assess reproducibility and statistical power

    • Consider risk of bias in different studies

  • Data Extraction:

    • Standardize outcome measures across studies

    • Record methodological variables (protein expression system, purification method, etc.)

    • Note host species, parasite strains, and experimental conditions

Statistical Approaches:

  • Effect Size Calculation:

    • Convert different outcome measures to standardized mean differences

    • Use odds ratios for binary outcomes

    • Apply random-effects models to account for heterogeneity

  • Moderator Analysis:

    • Identify methodological factors explaining disparate results

    • Test impact of biological variables (parasite isolate, host species)

    • Evaluate publication year to detect temporal trends

  • Publication Bias Assessment:

    • Generate funnel plots

    • Perform Egger's test

    • Apply trim and fill method if bias detected

Meta-analysis of RNA-seq data has already provided valuable insights into expression patterns across life stages , demonstrating how integrative approaches can resolve contradictions in individual studies and provide a more comprehensive understanding of this protein's biology.

How does post-translational modification affect the function and antigenicity of the Schistosoma japonicum 25 kDa integral membrane protein?

Post-translational modifications (PTMs) can significantly impact the function and antigenicity of the S. japonicum 25 kDa integral membrane protein. Researchers investigating this aspect should consider:

PTM Identification Methods:

  • Mass Spectrometry-Based Approaches:

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage

    • Label-free quantification of modification abundance

  • Site-Specific Analysis:

    • Site-directed mutagenesis of potential modification sites

    • Expression of protein in systems with different PTM capabilities

    • Biochemical assays targeting specific modifications

Functional Impact Assessment:

  • Trafficking and Localization:

    • Compare subcellular localization of modified vs. unmodified protein

    • Assess membrane incorporation efficiency

    • Evaluate protein stability and turnover rates

  • Protein-Protein Interactions:

    • Compare interaction profiles of modified vs. unmodified forms

    • Identify PTM-dependent binding partners

    • Measure binding kinetics with potential ligands

Immunological Consequences:

  • Epitope Accessibility:

    • Compare antibody recognition of glycosylated vs. deglycosylated protein

    • Evaluate impact of phosphorylation on antibody binding

    • Test recognition by sera from infected hosts at different stages

  • Diagnostic Implications:

    • Compare recombinant protein (from E. coli, limited PTMs) vs. native protein in diagnostic assays

    • Evaluate whether adding specific PTMs improves diagnostic performance

    • Assess cross-reactivity patterns of antibodies against differently modified forms

When expressing recombinant protein in E. coli , researchers should recognize that the bacterial system lacks many eukaryotic PTM capabilities, potentially affecting protein properties compared to the native form in the parasite.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.