Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Antigenic integral membrane glycoprotein; Antigen Sm25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-182
Protein Length
Full Length of Mature Protein
Species
Schistosoma mansoni (Blood fluke)
Target Protein Sequence
DFSTEIIMIQTINWIVWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSN NVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSA NKYMKNEFLMSSCIVITLNLFIFMYKS
Uniprot No.

Target Background

Function
A major surface tegument antigen.
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell membrane; Lipid-anchor.

Q&A

What are the major antigenic membrane glycoproteins identified in Schistosoma mansoni?

Schistosoma mansoni expresses numerous antigenic membrane glycoproteins, with significant research focusing on a library of 115 secreted and cell-surface proteins. These include single-pass transmembrane proteins, GPI-anchored proteins, and secreted proteins that can be classified into five broad functional categories. Notable examples include the large molecular weight proteins Sm200 (257 kDa) and α 2-macroglobulin (409 kDa), which have been successfully expressed and characterized in recombinant systems. These proteins represent valuable resources for immunological and functional studies of S. mansoni infection .

How do glycosylation patterns of S. mansoni membrane glycoproteins change during different life cycle stages?

The glycosylation patterns of S. mansoni membrane glycoproteins undergo significant changes during parasite development. During the transformation from cercariae (free-swimming larvae) to schistosomula (initial mammalian host stage), there are notable shifts in surface-exposed glycan antigens. While multifucosylated GalNAcβ1-4GlcNAc (LDN) motifs are expressed at the surface throughout these developmental stages, other motifs like Galβ1-4(Fucα1-3)GlcNAc (Lewis X) and GalNAcβ1-4(Fucα1-3)GlcNAc (LDN-F) become surface-exposed only after transformation to schistosomula. This temporal regulation appears to relate to the shedding of the O-glycan-rich cercarial glycocalyx after transformation, suggesting that the source of surface-accessible multifucosylated LDN motifs shifts from predominantly O-glycans in cercariae to glycosphingolipids in schistosomula .

What glycan structures are predominantly found on S. mansoni integral membrane glycoproteins?

S. mansoni integral membrane glycoproteins display a diverse array of unusual glycan structures that serve as key antigenic determinants. These include:

  • LDN (GalNAcβ1-4GlcNAc) motifs

  • Fucosylated LDN sequences (LDNF, LDN-dF, FLDN, and FLDNF)

  • Lewis X (Lex) and poly-Lewis X structures

  • Core α3 fucose and core β2 xylose modifications

In particular, glycoproteins like kappa-5 from S. mansoni eggs carry unique triantennary N-glycans with difucosylated and xylosylated core regions, terminating with immunogenic GalNAcβ1–4GlcNAc (LDN) structures. These glycan structures are recognized by the host immune system and induce specific antibody responses during infection .

What expression systems are most effective for producing recombinant S. mansoni membrane glycoproteins?

HEK293 mammalian cell expression systems have proven highly effective for producing recombinant S. mansoni membrane glycoproteins. This approach has successfully expressed 90% of targeted proteins, including very large proteins like Sm200 (257 kDa) and α 2-macroglobulin (409 kDa). The mammalian expression system is particularly advantageous as it enables proper folding and post-translational modifications of parasitic proteins. Following expression, proteins can be quantified by ELISA and their integrity verified through Western blotting to confirm expression at the expected molecular weight .

How can researchers overcome challenges in expressing large molecular weight S. mansoni membrane glycoproteins?

Expressing large molecular weight S. mansoni membrane glycoproteins presents several challenges, including potential protein misfolding, degradation, and insufficient yields. Successful expression requires:

  • Selection of an appropriate expression system (HEK293 cells have demonstrated success with proteins up to 409 kDa)

  • Optimization of expression vectors with strong promoters suitable for mammalian cells

  • Careful culture conditions monitoring and optimization

  • Verification of protein integrity through Western blotting to confirm the expected size

  • For particularly challenging proteins, consideration of expressing functional domains rather than full-length proteins

Even with these approaches, approximately 10% of target proteins may remain undetectable despite optimization efforts, necessitating alternative strategies for particularly challenging targets .

What purification strategies yield the highest purity of recombinant S. mansoni membrane glycoproteins for immunological studies?

For immunological studies requiring high purity recombinant S. mansoni membrane glycoproteins, a targeted glycoproteomic approach combining lectin affinity purification with subsequent mass spectrometry has proven effective. This approach allows for isolation of specific glycoprotein antigens like kappa-5 while preserving their native glycosylation patterns. Additionally, affinity chromatography using monoclonal antibodies specific to particular glycan epitopes can be employed to isolate glycoproteins bearing specific antigenic determinants. Following initial purification, size exclusion chromatography and ion exchange chromatography may be utilized to achieve higher purity levels suitable for detailed structural analyses and immunological assays .

What advanced analytical techniques are most informative for characterizing the glycan structures of S. mansoni membrane glycoproteins?

Comprehensive characterization of S. mansoni membrane glycoprotein glycans requires a multi-analytical approach:

  • Mass spectrometry (MS): Particularly useful for N-glycan structural analysis after enzymatic release from glycoproteins. Techniques like liquid chromatography-mass spectrometry (LC-MS) and matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) MS are commonly employed.

  • Shotgun glycomics: This approach involves preparation, derivatization, and separation of glycans from schistosome proteins, followed by microarray generation and interrogation with sera from infected hosts and glycan-binding proteins.

  • Metadata-assisted glycan sequencing (MAGS): Combines mass spectrometry with lectin and antibody binding studies to comprehensively identify glycan structures.

These techniques have successfully identified unique structures in S. mansoni glycoproteins, such as the triantennary N-glycans with difucosylated and xylosylated core regions found in kappa-5 .

How can researchers distinguish between similar glycan epitopes on S. mansoni membrane glycoproteins?

Distinguishing between similar glycan epitopes on S. mansoni membrane glycoproteins requires a multi-faceted approach:

  • Use of well-characterized monoclonal antibodies with defined specificities, such as F2D2 which specifically recognizes the FLDNF epitope [Fucα3GalNAcβ4(Fucα3)GlcNAc-R].

  • Microarray analysis using natural glycan arrays generated from parasite material compared against synthetic glycan arrays with defined structures.

  • Competing binding assays with purified glycan standards to determine relative binding affinities.

  • Sequential enzymatic digestion with specific glycosidases that selectively cleave particular glycan linkages, followed by assessment of antibody binding to determine epitope structure.

  • Comparative analysis across parasite developmental stages, as certain epitopes show stage-specific surface expression patterns, such as Lewis X and LDN-F motifs that become surface-expressed only after transformation of cercariae to schistosomula .

How do immune responses to S. mansoni membrane glycoproteins differ among various infected host species?

Immune responses to S. mansoni membrane glycoproteins exhibit significant variations among different infected host species:

  • Rhesus monkeys (which naturally self-cure after infection) generate IgG antibodies against multiple glycan antigens including Lewis X, LDN, LDNF, core fucose, and core xylose determinants. Their sera effectively mediate complement-dependent cytolysis of schistosomulum larvae in vitro.

  • Infected humans produce primarily IgM antibodies, but also IgG and IgA, targeting LDN, LDNF, and Lewis X structures. Interestingly, antibody titers against certain glycan structures like LDN-dF and FLDN are higher in infected children compared to adults.

  • Mice show unique patterns of anti-glycan antibody responses that differ from primates in specificity, titers, and isotype composition when analyzed against schistosome-type biantennary N-glycans.

These species-specific differences in immune recognition may contribute to varying levels of protection against infection and pathology development across different host species .

What is the significance of FLDNF epitopes on S. mansoni membrane glycoproteins in the context of host immune responses?

The FLDNF epitope [Fucα3GalNAcβ4(Fucα3)GlcNAc-R] represents a major glycan antigen targeted by IgG antibodies from various infected species including mice, rhesus monkeys, and humans. This epitope is also recognized by the IgG monoclonal antibody F2D2. The immunological significance of FLDNF lies in:

  • Its expression across all life stages of the parasite in mammalian hosts, making it a persistent antigenic target.

  • Its ability to induce protective immune responses, as demonstrated by the capability of F2D2 antibody to kill schistosomula in vitro through complement-dependent mechanisms.

  • Its potential role as a diagnostic marker and vaccine candidate due to its high immunogenicity and conservation across parasite developmental stages.

The robust immune recognition of this glycan epitope suggests it plays an important role in host-parasite interactions during S. mansoni infection .

How do antibodies against specific glycan epitopes on S. mansoni membrane glycoproteins contribute to parasite killing?

Antibodies against specific glycan epitopes on S. mansoni membrane glycoproteins contribute to parasite killing through several mechanisms:

  • Complement-mediated cytotoxicity: Monoclonal antibodies like F2D2, which targets the FLDNF epitope, can mediate killing of schistosomula in vitro in a complement-dependent manner. Similarly, sera from S. mansoni-infected rhesus monkeys containing antibodies to glycan determinants effectively mediate complement-dependent cytolysis of schistosomulum larvae.

  • Surface targeting: These antibodies recognize glycan epitopes expressed on the parasite surface, particularly on 3-hour-old schistosomula, making the parasite vulnerable to immune attack during the early stages of host infection.

  • Stage-specific recognition: The differential expression of glycan epitopes across parasite developmental stages influences the effectiveness of antibody-mediated killing. For example, the surface expression of Lewis X and LDN-F motifs changes during cercarial transformation to schistosomula, potentially affecting parasite susceptibility to antibody-mediated killing.

These mechanisms suggest that glycan-specific antibodies play important roles in protective immunity against S. mansoni, particularly in naturally resistant hosts like rhesus monkeys that develop self-cure mechanisms .

How can recombinant S. mansoni membrane glycoproteins be optimized for diagnostic assay development?

Optimizing recombinant S. mansoni membrane glycoproteins for diagnostic assay development requires addressing several critical factors:

  • Selection of appropriate antigenic targets: The library of 115 secreted and cell-surface proteins represents a valuable resource for identifying optimal diagnostic markers. Research has identified proteins that can detect primary infections with as few as 10 parasites and as early as 5 weeks post-infection .

  • Expression system optimization: Ensuring proper glycosylation patterns that mirror native parasite glycoproteins is essential, as many diagnostic antibodies target glycan epitopes rather than protein backbones. HEK293 mammalian expression systems have proven effective for producing correctly folded and glycosylated recombinant proteins .

  • Epitope preservation: Maintaining the integrity of key antigenic determinants, particularly unique glycan structures like FLDNF, LDN-F, and Lewis X motifs that elicit strong antibody responses in infected hosts .

  • Assay format selection: Developing multiplex assays that simultaneously detect antibodies against multiple glycoprotein antigens may improve diagnostic sensitivity and specificity, especially for distinguishing active from past infections.

  • Validation across diverse patient populations: Accounting for differences in antibody responses between children and adults, as well as across different endemic regions, to ensure broad diagnostic utility .

What are the key challenges in developing vaccines based on S. mansoni membrane glycoproteins?

Developing vaccines based on S. mansoni membrane glycoproteins faces several significant challenges:

  • Glycan heterogeneity: The complex and heterogeneous nature of glycan structures on S. mansoni membrane glycoproteins makes consistent production of recombinant antigens with native-like glycosylation extremely difficult.

  • Developmental stage variation: Surface expression patterns of glycan antigens change during S. mansoni development, as seen with Lewis X and LDN-F motifs that become surface-exposed only after transformation of cercariae to schistosomula. This temporal regulation complicates the selection of antigens that will target multiple life-cycle stages .

  • Host species differences: Variations in immune responses to S. mansoni glycan antigens among different host species (humans, rhesus monkeys, mice) complicate the translation of vaccine candidates from animal models to human applications .

  • Immune evasion mechanisms: S. mansoni employs sophisticated immune evasion strategies, including antigenic variation and immunomodulation, which may limit vaccine efficacy.

  • Manufacturing complexity: Producing recombinant glycoproteins with precise, parasite-specific glycan structures at scale presents significant bioprocessing challenges that must be overcome for vaccine development.

How can shotgun glycomics approaches advance the identification of protective S. mansoni glycoprotein antigens?

Shotgun glycomics approaches offer powerful methods for identifying protective S. mansoni glycoprotein antigens through several advantages:

  • Comprehensive antigen profiling: By generating natural N-glycan microarrays from S. mansoni egg glycoproteins, researchers can simultaneously screen numerous potential antigens against sera from infected hosts to identify immunologically relevant structures .

  • Comparative immunology insights: Interrogating these arrays with sera from different infected species (mice, rhesus monkeys, humans) reveals both similarities and differences in anti-glycan antibody specificities, titers, and isotype compositions, helping to identify universally recognized protective antigens .

  • Structure-function correlation: The combination of glycomics and immunological techniques allows researchers to identify disease-relevant glycan antigens, as demonstrated with the identification of the FLDNF epitope recognized by the F2D2 monoclonal antibody that mediates killing of schistosomula in vitro .

  • Target prioritization: By correlating glycan structure with immunological activity, shotgun glycomics helps prioritize specific antigenic determinants for further vaccine development, focusing resources on the most promising candidates.

  • Novel reagent development: This approach facilitates the development of new anti-glycan reagents with potential diagnostic applications and contributions to vaccine development strategies .

What are the most effective strategies for studying the dynamics of S. mansoni glycoprotein expression during parasite development?

Studying the dynamics of S. mansoni glycoprotein expression during parasite development requires integrated multimodal approaches:

  • Immunofluorescence microscopy: This technique effectively tracks the binding of anti-glycan monoclonal antibodies to parasite surfaces across developmental stages. For example, analyzing cercariae and schistosomula up to 72h after transformation has revealed stage-specific changes in surface glycan expression .

  • Glycan microarray analysis: Comparing binding profiles of stage-specific glycans against well-characterized antibodies and lectins helps map developmental changes in glycan expression patterns .

  • Transcriptomics integration: Combining glycan analysis with transcriptomic data, particularly for membrane and secreted proteins that are underrepresented in proteomics datasets, helps identify stage-specific gene expression patterns. This approach has been successfully used to identify transcripts enriched at 48 versus 3 hours post-infection .

  • Comparative proteomics: Analyzing the proteome of different parasite life stages provides complementary information about the expression of glycoprotein backbones that carry specific glycan structures .

  • Functional immunological assays: Evaluating the susceptibility of different parasite stages to antibody-mediated killing in complement-dependent cytotoxicity assays provides insights into the functional significance of developmental changes in glycan expression .

How can researchers effectively distinguish between N-linked and O-linked glycans on S. mansoni membrane glycoproteins?

Distinguishing between N-linked and O-linked glycans on S. mansoni membrane glycoproteins requires a systematic approach combining multiple analytical techniques:

  • Enzymatic digestion: Treating glycoproteins with PNGase F specifically cleaves N-glycans while leaving O-glycans intact. Comparing glycan profiles before and after treatment helps differentiate between these two classes.

  • Site-specific glycopeptide analysis: Mass spectrometry analysis of glycopeptides can identify specific N-glycosylation sites (consensus sequence N-X-S/T, where X ≠ P) and O-glycosylation sites (typically on serine or threonine residues).

  • Developmental stage comparison: Analyzing cercariae (with O-glycan-rich glycocalyx) versus schistosomula (after glycocalyx shedding) provides insights into the distribution of glycan types. Research has shown that multifucosylated LDN-motifs are present on cercarial glycocalyx-derived O-glycans, while in schistosomula these motifs are predominantly found on glycosphingolipids .

  • Structural characterization: N-glycans from S. mansoni typically display unique features like core β-xylose and core α3-fucose modifications, as seen in the triantennary N-glycans of kappa-5 with difucosylated and xylosylated core regions .

  • Lectins with differential binding specificities: Certain lectins preferentially bind either N-linked or O-linked glycans, providing another method to distinguish between these glycan classes.

What novel experimental approaches can advance our understanding of glycosylation's role in S. mansoni immune evasion?

Advancing our understanding of glycosylation's role in S. mansoni immune evasion requires innovative experimental approaches:

  • Temporal glycomic profiling: Analyzing changes in surface glycan expression during the transformation from cercariae to schistosomula and subsequent developmental stages can reveal how glycan remodeling contributes to immune evasion. This is particularly relevant as research has documented the shedding of O-glycan-rich cercarial glycocalyx after transformation, suggesting a strategic glycan reorganization to evade host immunity .

  • CRISPR-Cas9 gene editing: Targeting specific glycosyltransferase genes in S. mansoni to generate parasites with altered glycosylation patterns would allow direct assessment of how specific glycan structures contribute to immune evasion.

  • Single-cell glycomics: Developing methodologies to analyze glycan expression at the single-cell level would reveal heterogeneity within parasite populations that may contribute to differential susceptibility to host immune responses.

  • Host-parasite glycan interaction mapping: Using techniques like glycan microarrays probed with host immune receptors (e.g., C-type lectins, siglecs) to identify specific glycan-receptor interactions that may modulate host immunity.

  • Immunization studies with defined glycan structures: Comparing protection induced by native glycoproteins versus recombinant proteins with simplified glycan patterns would help identify which specific glycan structures are essential for protective immunity versus those that may contribute to immune evasion .

What experimental models best recapitulate the human immune response to S. mansoni membrane glycoproteins?

The selection of experimental models for studying human immune responses to S. mansoni membrane glycoproteins requires careful consideration of species-specific differences:

  • Non-human primates: Rhesus monkeys represent one of the best models as they naturally self-cure after S. mansoni infection and generate antibodies against multiple glycan antigens including Lewis X, LDN, LDNF, core fucose, and core xylose determinants. Their antibody responses more closely resemble human patterns than those of rodent models .

  • Humanized mouse models: Mice engrafted with human immune system components offer potential advantages for studying human-specific immune responses to S. mansoni glycoproteins, though these models continue to be refined.

  • In vitro human cellular systems: Human dendritic cell and T cell co-culture systems challenged with recombinant S. mansoni glycoproteins can model initial immune recognition and response development.

  • Comparative immunological approaches: Analyzing sera from infected humans, rhesus monkeys, and mice against the same glycan microarrays provides valuable insights into species-specific immune recognition patterns and helps identify conserved responses that may be most relevant to human immunity .

  • Ex vivo human studies: Examining immune responses in cells isolated from S. mansoni-infected individuals or endemic populations provides the most directly relevant information about human recognition of parasite glycoproteins.

How do different S. mansoni strains vary in their membrane glycoprotein expression and antigenicity?

Variation in membrane glycoprotein expression and antigenicity across different S. mansoni strains represents an important but understudied aspect of parasite biology. Key considerations include:

Systematic comparative glycomics studies across diverse S. mansoni strains would provide valuable insights into the extent and immunological significance of these variations.

How can systems biology approaches integrate glycomic, transcriptomic, and immunological data to advance S. mansoni vaccine development?

Systems biology approaches offer powerful frameworks for integrating multiple data types to accelerate S. mansoni vaccine development:

  • Multi-omics data integration: Combining glycomics, transcriptomics, proteomics, and immunological datasets enables identification of relationships between gene expression, glycan synthesis, and immune recognition of membrane glycoproteins.

  • Network analysis: Constructing interaction networks between parasite glycans and host immune receptors helps identify key nodes that could be targeted for vaccine development.

  • Machine learning predictive models: Developing algorithms to predict immunogenic glycan structures based on their chemical features and pattern recognition by host immune factors.

  • Temporal dynamics modeling: Integrating data on glycan expression changes during parasite development with corresponding host immune responses to identify optimal timing for vaccine-induced immunity.

  • Reverse vaccinology: Using computational prediction of surface-exposed glycoprotein epitopes combined with experimental validation of their immunogenicity in different host species.

This integrated approach has already shown promise, as demonstrated by studies that combined glycomics and immunological techniques to identify disease-relevant glycan antigens like the FLDNF epitope, which is recognized by the protective monoclonal antibody F2D2 .

What emerging technologies could revolutionize our ability to produce and analyze recombinant S. mansoni membrane glycoproteins?

Several emerging technologies show promise for transforming research on recombinant S. mansoni membrane glycoproteins:

  • Glycoengineered expression systems: Developing cell lines with humanized or parasite-specific glycosylation machinery could enable production of recombinant proteins with more authentic glycan structures for immunological studies and vaccine development.

  • Cell-free glycoprotein synthesis: Combining in vitro translation systems with defined glycosyltransferases could allow precise control over glycan structures on recombinant membrane proteins.

  • Cryo-electron microscopy: Advanced structural analysis of membrane glycoprotein complexes in near-native states would provide unprecedented insights into the three-dimensional arrangement of glycan epitopes.

  • Single-molecule glycan sequencing: Development of technologies for direct sequencing of intact glycans would revolutionize our ability to characterize complex glycan structures on S. mansoni membrane glycoproteins.

  • Glycan-specific CRISPR screening: Developing high-throughput methods to simultaneously disrupt multiple glycosylation-related genes in S. mansoni would accelerate understanding of glycan function in host-parasite interactions.

These technologies could overcome current limitations in producing and analyzing the complex glycan structures that characterize S. mansoni membrane glycoproteins.

How might understanding S. mansoni membrane glycoprotein structure and immunogenicity inform vaccine development for other helminth infections?

Insights from S. mansoni membrane glycoprotein research have broad implications for vaccine development against other helminth parasites:

  • Cross-reactive glycan epitopes: Many helminth parasites share common glycan structures, such as core α3-fucose and β2-xylose modifications on N-glycans. Understanding the immunogenicity of these structures in S. mansoni could inform vaccine approaches for other species.

  • Immunomodulatory mechanisms: Helminths often employ similar strategies to manipulate host immunity through glycan-mediated mechanisms. Lessons from S. mansoni regarding which glycan structures promote protective versus regulatory immune responses could guide vaccine design for related parasites.

  • Expression system optimization: Methods developed to produce recombinant S. mansoni glycoproteins with authentic glycosylation could be adapted for other helminth antigens that present similar expression challenges.

  • Antigen delivery platforms: Strategies to effectively present S. mansoni glycan antigens to the immune system might be applicable to other helminth vaccines where glycan epitopes are important targets.

  • Diagnostic cross-reactivity considerations: Understanding shared glycan epitopes among helminths helps address potential diagnostic cross-reactivity issues that could complicate vaccine evaluation in co-endemic regions.

The comprehensive library of 115 recombinant S. mansoni secreted and cell-surface proteins represents a valuable template for similar approaches with other helminth parasites .

What are the most promising strategies for improving the efficiency of recombinant S. mansoni membrane glycoprotein production for large-scale applications?

Improving production efficiency of recombinant S. mansoni membrane glycoproteins for large-scale applications requires addressing several challenges:

  • Optimized vector design: Developing expression vectors with codon optimization, efficient secretion signals, and precise epitope tagging would enhance protein yields while facilitating purification.

  • Advanced cell line engineering: Creating stable producer cell lines with enhanced capacity for complex glycosylation and high-level expression of membrane proteins would increase production consistency and scale.

  • Bioprocess optimization: Developing serum-free suspension culture protocols specifically tailored for S. mansoni glycoprotein expression would improve scalability and reduce production costs.

  • Simplified glycoprotein designs: Identifying the minimal glycoprotein domains and glycan structures required for immunological activity could enable production of smaller, more expressible constructs with retained functionality.

  • Alternative expression platforms: Exploring non-mammalian systems engineered to produce parasite-like glycosylation patterns, such as modified insect cells or yeast strains, could provide more cost-effective production alternatives.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.