Recombinant Schizophyllum commune Cytochrome c oxidase subunit 3 (COIII)

Shipped with Ice Packs
In Stock

Description

Functional Insights

  • Enzyme Assembly: Facilitates proper folding and integration of other oxidase subunits during biosynthesis .

  • Proton Channel Regulation: Modulates proton flow via conserved acidic residues (e.g., E98, D259), though compensatory mechanisms allow residual activity in its absence .

4.1. Biochemical Studies

  • Proton Pump Mechanisms: Used to investigate COIII’s role in proton translocation through site-directed mutagenesis (e.g., E98A/D259A variants) .

  • Structural Biology: Partial-length COIII aids in crystallography and membrane protein dynamics studies .

4.2. Industrial Relevance

  • Enzyme Engineering: S. commune’s lignocellulose-degrading enzymes are biotechnologically valuable , though COIII itself is primarily a research tool.

Genomic Context

The S. commune genome (38.5 Mb) encodes 13,210 genes, including transcription factors regulating mushroom development . While COIII is not directly implicated in developmental pathways, its mitochondrial gene’s conservation across fungi underscores evolutionary stability .

Limitations and Future Directions

  • Partial Protein: The recombinant COIII lacks full-length sequence, limiting functional studies on holocomplex interactions .

  • Unresolved Role: Further research is needed to clarify COIII’s species-specific contributions to oxidase assembly versus proton transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. Should you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development for your order.
Synonyms
COIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Schizophyllum commune (Split gill fungus)
Target Names
COIII
Target Protein Sequence
MTSIKFYQSFSAHLVQHSPWPILVSFSLFNLAIGTVLTMHGYSHSSTTFDLGLAVTVGSI LLWTRDIVIEGSFLGDHTKQVQEGLIIGFILFIISEVFAFISVFWAYFHSALSPAVELGS TWPPVGIIPLDTFSLPLFNTIILLSSGAFVTYGHHAIFSGKRLDSIIGLFLTVALALIFS YFQAFEYIHAGFSMSDSVFGTVFFASTGLHGIHVMLGTLFLFVSFLRQVNYQTTKEHNIG LETSILYWHFVDLVWLFLFLVVYFWGGA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COIII) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain encompasses three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that powers transmembrane transport and ATP synthase. Cytochrome c oxidase, specifically, catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is the COIII gene organized in the S. commune genome?

The cytochrome oxidase subunit III gene (COIII) of S. commune has been identified, cloned, and sequenced. Unlike many mitochondrial genes in fungi, the COIII gene in S. commune contains no introns, which is significant for expression studies . The gene is notably AT-rich with approximately 69% AT content, reflecting the typical nucleotide bias in fungal mitochondrial genomes .

An interesting characteristic of the S. commune COIII gene is its codon usage pattern. While most mitochondrial genes in fungi use both TGA and TGG codons to specify tryptophan, the COIII gene of Schizophyllum uses TGG exclusively . Additionally, translation of the gene follows the universal genetic code without deviations, which differs from some other fungal mitochondrial genes that may utilize alternative codon assignments .

For researchers studying this gene, methods involving PCR amplification should account for this AT-richness when designing primers and optimizing reaction conditions.

What molecular techniques are available for studying COIII function in S. commune?

Multiple molecular approaches have been developed for investigating COIII function in S. commune:

  • Gene deletion methods: Recent advances using CRISPR/Cas9 ribonucleoproteins (RNPs) have greatly improved the efficiency of targeted gene deletions in S. commune. Pre-assembled Cas9-sgRNA complexes can be delivered to protoplasts via PEG-mediated transformation, eliminating the need to optimize cas9 and sgRNA expression .

  • Site-directed mutagenesis: This approach has been successfully employed to modify specific conserved residues (such as E98 and D259) to study their functional significance .

  • Heterologous expression: Recombinant COIII protein can be produced in various expression systems for in vitro studies, with the protein typically stored in Tris-based buffer with 50% glycerol for stability .

  • Functional assays: Activity measurements and spectroscopy techniques allow researchers to assess the impact of mutations or deletions on enzyme function and electron transfer capabilities .

What role does COIII play in proton translocation in S. commune?

The role of COIII in proton translocation has been a subject of significant debate. Historical research suggested that COIII was critical for the proton pumping activity of cytochrome c oxidase, particularly because dicyclohexyl carbodiimide (DCCD) modification of a conserved glutamic acid residue (E98) in COIII was observed to abolish proton translocation activity .

  • Site-directed mutagenesis of conserved residues

  • Spectroscopic analysis of the resulting mutant enzymes

  • Electron transfer activity measurements

  • Proton translocation assays using bacterial spheroplasts

How can CRISPR/Cas9 be used for efficient COIII gene manipulation in S. commune?

CRISPR/Cas9 technology has revolutionized genetic manipulation in S. commune. For COIII studies, researchers can now use pre-assembled Cas9-sgRNA ribonucleoproteins (RNPs) delivered directly to protoplasts:

Methodological procedure:

  • sgRNA design: Design a ~100 bp single guide RNA targeting a 20 bp homology sequence within the COIII gene .

  • RNP complex formation: Pre-assemble the Cas9 protein with in vitro transcribed sgRNA to form the RNP complex .

  • Repair template design: Create a repair template containing a selectable marker (such as nourseothricin resistance) flanked by homology arms. Research indicates that homology arms as short as 250 bp are sufficient to induce homologous recombination efficiently .

  • Transformation: Deliver all components (Cas9 protein, sgRNA, and repair template) to wild-type protoplasts via PEG-mediated transformation .

  • Screening: Select transformants on appropriate antibiotic media and confirm gene deletion through PCR and sequencing .

Efficiency considerations:

The efficiency of COIII deletion can be significantly enhanced by using a Δku80 background strain, which shows increased rates of homologous recombination due to the elimination of the non-homologous end-joining (NHEJ) pathway . In wild-type backgrounds, the efficiency of homologous recombination is typically lower in basidiomycetes like S. commune compared to ascomycete model systems .

What are the evolutionary implications of S. commune COIII genetic features?

The evolutionary analysis of S. commune COIII reveals several intriguing characteristics:

  • Codon usage: The exclusive use of TGG codons for tryptophan in S. commune COIII differs from the pattern in most mitochondrial genes, which typically use both TGA and TGG codons . This suggests potential selective pressure on codon optimization or evolutionary divergence in the translation machinery.

  • Sequence conservation: Despite being a basidiomycete, S. commune COIII exhibits significant sequence similarity to homologous genes in ascomycetes , indicating functional conservation across divergent fungal lineages.

  • Intron absence: The lack of introns in the COIII gene contrasts with many other fungal mitochondrial genes . This characteristic simplifies gene expression and may represent either an ancestral state or secondary loss during evolution.

Research methodologies for evolutionary studies typically involve:

  • Comparative genomic analyses across multiple fungal species

  • Phylogenetic reconstruction using maximum likelihood or Bayesian approaches

  • Analysis of selective pressures using dN/dS ratios

  • Examination of codon usage bias and nucleotide composition

These evolutionary insights provide context for understanding the unique features of S. commune COIII and its relationship to homologous proteins across the fungal kingdom.

How do post-translational modifications affect COIII function in cytochrome c oxidase?

Post-translational modifications (PTMs) of COIII can significantly impact protein function and enzyme activity. Of particular importance is the modification by dicyclohexyl carbodiimide (DCCD), which targets the conserved glutamic acid residue E98 .

Research approaches to study PTMs in COIII include:

  • Mass spectrometry analysis: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify specific modifications and their locations within the protein sequence.

  • Site-directed mutagenesis: Replacing modifiable residues (such as E98 and D259) with non-modifiable alternatives allows researchers to assess the functional importance of specific PTMs .

  • Activity assays: Comparing electron transfer rates and proton pumping efficiency between modified and unmodified forms of the enzyme provides insights into the functional consequences of PTMs.

  • Structural analysis: Techniques such as X-ray crystallography or cryo-EM can reveal how modifications alter protein conformation and interaction surfaces.

What methodologies are optimal for purification and characterization of recombinant S. commune COIII?

Purification and characterization of recombinant S. commune COIII requires specialized approaches due to its membrane protein nature:

Purification strategy:

  • Expression system selection: Heterologous expression in systems capable of proper membrane protein folding and post-translational modifications (yeast or insect cells are often preferred).

  • Affinity chromatography: Utilizing fusion tags (His-tag or other affinity tags) for initial capture, with tag selection determined during the production process .

  • Detergent solubilization: Careful selection of detergents that maintain protein structure while extracting from membranes.

  • Size exclusion chromatography: Further purification based on molecular size to achieve high purity.

Storage conditions:
The purified protein should be stored in a Tris-based buffer with 50% glycerol for stability . For extended storage, conservation at -20°C or -80°C is recommended, with repeated freeze-thaw cycles avoided by creating working aliquots stored at 4°C for up to one week .

Characterization techniques:

  • Spectroscopic analysis: UV-visible spectroscopy to examine heme environments and protein folding.

  • Activity assays: Measurement of electron transfer rates and coupling to proton translocation.

  • Proteoliposome reconstitution: Incorporation into artificial membrane systems to study function in a membrane environment.

  • Structural studies: X-ray crystallography, NMR (for specific domains), or cryo-EM to determine three-dimensional structure.

These methodological approaches provide a comprehensive framework for researchers working with recombinant S. commune COIII, enabling detailed investigations of this important component of the mitochondrial respiratory chain.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.