Recombinant Schizophyllum commune Pheromone B alpha 1 receptor (BAR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this information in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BAR1; Pheromone B alpha 1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-639
Protein Length
full length protein
Species
Schizophyllum commune (Split gill fungus)
Target Names
BAR1
Target Protein Sequence
MLDPLYPLFPIFAFLGFVLAILPLPWHLQAWNSGTCFFMMWTALGCLNQFINSVAWADDA MNKAPVWCEISIRILMGASVGIPASSLCIIRRLYYIAKVRAVSKTRAEKMRAILVDALIC VLFPLVYIALQYIVQGHRFNILENIGCYPAVTNTPVTYVVSYVWPVLLGLISATYGVMAL LQFNKHRLQFSQFLHTHSTLSASRYLRLMALALTEMMCTMPLGIFVIVLNSKTENIQPWV SLAVTHYGFGRIDQVPAIVWRSQHLIVVCNELTRWCAPVSAFIFFFYFGFAEEARRNYAA AWRRVCRALGLPERVPSLPTTKKPFSSSDNKGSGFAEKFAAKAKGFSNFNVKDFTSEFTS KAHDFTSKAKQYTLPRPMPQTLSSSGFSSSDSTRFGSSVDGKELPSPTTKEFSSPIPIHL SGMQTLASFDSNKDLPSPPAYDIEAQYGPYNIDNRVSYHIADTGVRASYPMGVAYSSDSE HRRIVPHHSTVPHHSTADEPASPALPDTPSSCSSSATFSTLQSRDFIVLPSSADVTRRDS GSSAGGVASTSRPTRAGPPRLPSLSQLFGISSMRGQEGDVEAQGEEMAADVDVSEMVLDT LAPASIIAATTTAGAPATTTPDRGEPDVPTSPRTHRASV
Uniprot No.

Target Background

Function
This protein serves as the receptor for the BAP1 pheromone, a prenylated mating factor. It plays a crucial role in initiating B-regulated nuclear migration.
Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the BAR1 receptor in Schizophyllum commune and what is its function?

The BAR1 receptor in Schizophyllum commune is a Ste3-like pheromone receptor encoded at the B mating-type locus, specifically within the Bα sublocus. BAR1 belongs to the G protein-coupled receptor (GPCR) family and plays a critical role in the mating-type recognition system of this basidiomycete fungus. The receptor recognizes specific pheromones secreted by compatible mating partners, initiating signal transduction pathways that lead to dikaryotization and subsequent fruiting body development .

The B mating-type locus in S. commune is organized into two subloci (Bα and Bβ), spanning approximately 32 kb with a 7 kb distance between the subloci. The BAR1 receptor gene is positioned within a highly conserved syntenic region across different S. commune strains, flanked by zinc finger transcription factors and other regulatory elements .

How does the B mating-type system function in S. commune?

The B mating-type system in S. commune operates through a tetrapolar mating mechanism where compatible interactions are determined by both A and B loci. While the A locus encodes homeodomain transcription factors, the B locus encodes pheromones and pheromone receptors in multiple allelic specificities .

When compatible mating occurs, the establishment of a fertile dikaryon is initiated, which under favorable environmental conditions can develop into fruiting bodies. Within the basidia, karyogamy and meiosis take place, linking spore production to compatible mating interactions . The BAR1 receptor specifically functions within this system by recognizing appropriate pheromone signals to activate downstream pathways necessary for sexual development.

How is the B mating-type locus organized in relation to BAR1?

The B mating-type locus in S. commune demonstrates a highly conserved genomic organization across different strains. Genomic analysis of multiple S. commune strains (H4-8, TatD, and LoeD) reveals striking synteny in gene order and neighboring genes .

BAR1 is located within the Bα sublocus, with specific pheromone receptor-like (brl) genes organized around it. The brl1 gene is positioned upstream of BAR1, while brl2 and brl3 are located downstream. All these receptor genes maintain consistent positions across different strains, though more distal genes show greater variability. The gene organization can be represented as:

RegionGene OrganizationConservation Level
Upstream of BAR1Zinc finger TF → brl1 → BAR1Highly conserved
Downstream of BAR1BAR1 → brl2 → brl3Highly conserved
Distal regionsVarious cytoskeleton-related genesMore variable

This conserved synteny suggests evolutionary pressure to maintain the organization of this critical mating locus .

How is BAR1 expression regulated during different developmental stages?

Expression analysis of pheromone receptor genes in S. commune, including BAR1 and related receptor-like (brl) genes, shows differential regulation during various developmental stages. Research indicates that these genes likely have functions beyond mere mating recognition, potentially influencing both filamentous growth and sexual development .

Based on qPCR studies, BAR1 expression patterns correlate with key developmental transitions. The receptor shows baseline expression in monokaryotic mycelia, with significant upregulation during compatible mating interactions and fruiting body formation. This expression pattern aligns with its role in sensing compatible mating partners and facilitating downstream developmental processes .

The regulation of BAR1 appears to be coordinated with related receptor genes. For instance, expression analysis of brl genes during different developmental stages suggests they may have complementary or overlapping functions with BAR1 in both vegetative growth and mating processes .

What signaling pathways are activated downstream of BAR1 receptor stimulation?

BAR1 receptor activation triggers multiple interconnected signaling cascades in S. commune. When the receptor binds its cognate pheromone, it activates at least two major signaling pathways:

  • MAPK (Mitogen-Activated Protein Kinase) signaling: BAR1 activation stimulates MAPK pathway components, which are associated with mating processes. Constitutively active Ras1 alleles (Ras1<sup>G12V</sup> and Ras1<sup>Q61L</sup>) show strong phenotypes for mating processes associated with MAPK signaling .

  • cAMP-dependent Protein Kinase A (PKA) pathway: Research demonstrates that Ras1-dependent, cAMP-mediated signal transduction is involved in fruiting body formation. Constitutively active Ras1 strains, as well as Δgap1 mutant strains (with enhanced Ras signaling), exhibit significantly increased Tpk (PKA catalytic subunit) activity .

These pathways ultimately converge to regulate gene expression networks controlling cellular processes required for successful mating and subsequent development. Transcriptome analyses of strains with altered signaling (constitutively active Ras1, deleted RasGap1, or constitutively active Cdc42) reveal specific transcriptional programs that correspond to the distinct phenotypic outcomes of these mutations .

How do BAR1 and related receptor-like genes (brl) differ functionally?

The S. commune genome contains multiple pheromone receptor-like genes with distinct genomic locations and potentially different functions. Four pheromone receptor-like genes (brl1, brl2, brl3, and brl4) have been identified, with brl1, brl2, and brl3 located at the B mating-type locus, whereas brl4 is positioned elsewhere in the genome .

Functional characterization through overexpression studies suggests differential roles:

ReceptorGenomic LocationProposed Function
BAR1B mating-type locus (Bα)Primary mating pheromone reception
brl1Upstream of BAR1Likely involved in mating processes
brl2, brl3Downstream of BAR1Roles in filamentous growth and development
brl4Separate from B locusFunction in vegetative growth regulation

Sequence analysis and functional characterization of brl-overexpression mutants particularly suggest that Brl1 may play a role in mating processes, while the others likely contribute to different aspects of growth and development. This functional diversification indicates an evolutionary expansion of pheromone receptor signaling systems beyond strict mating type determination .

What are the most effective methods for generating recombinant BAR1 for functional studies?

Creating recombinant BAR1 for functional studies requires specialized approaches due to the challenges of working with membrane proteins. Based on methodologies applied to similar fungal GPCRs, several approaches can be effective:

How can CRISPR-Cas9 technology be adapted for BAR1 genetic manipulation?

CRISPR-Cas9 technology has been successfully implemented in S. commune and can be adapted for precise BAR1 manipulation using the following optimized methodology:

  • RNP Complex Preparation: Pre-assembled Cas9-sgRNA ribonucleoproteins (RNPs) have proven effective in S. commune. This approach eliminates the need to optimize cas9 and sgRNA expression within the fungus .

  • Guide RNA Design: For BAR1 targeting, design sgRNAs targeting specific regions of the BAR1 gene using standard CRISPR design tools. Critical considerations include:

    • Minimizing off-target effects

    • Selecting target sites with PAM sequences accessible in the chromatin context

    • Designing multiple sgRNAs for higher efficiency

  • Repair Template Design: For gene replacement or modification, construct a repair template with appropriate homology arms. In S. commune, homology arms of at least 250 bp are sufficient to efficiently induce homologous recombination .

  • Transformation Protocol:

    • Supply all components (Cas9 protein, sgRNA, and repair template with selectable marker) to wild-type protoplasts via PEG-mediated transformation

    • For maximum efficiency, consider using a Δku80 background strain, which has shown increased gene deletion efficiency due to reduced non-homologous end joining (NHEJ)

  • Selection and Verification: Select transformants using appropriate antibiotics (phleomycin or nourseothricin) at concentrations of 15-25 μg/mL. Verify successful modifications through sequencing and functional assays .

While this approach is effective, note that the efficiency is significantly lower than in ascomycete fungi—screening of numerous colonies is typically required to identify successful transformants .

How can transcriptome analysis be used to characterize BAR1 signaling networks?

Transcriptome analysis offers powerful insights into BAR1 signaling networks. Based on studies of related signaling pathways in S. commune, the following methodology is recommended:

  • Experimental Design: Compare transcriptomes across multiple genetic backgrounds:

    • Wild-type strains

    • BAR1 deletion mutants

    • Strains with constitutively active downstream components (e.g., Ras1<sup>G12V</sup>)

    • Strains with differential BAR1 activation states

  • Sample Preparation Protocol:

    • Extract total RNA using RNeasy Plant Mini Kit or equivalent

    • Perform reverse transcription with QuantiTect Reverse Transcription Kit

    • Use high-quality RNA (RIN > 8) for library preparation

  • RNA-Seq Analysis Pipeline:

    • Illumina sequencing with >20 million reads per sample

    • Quality filtering and adapter trimming

    • Mapping to the S. commune reference genome

    • Differential expression analysis using DESeq2 or similar tools

  • Data Integration Approach:

    • Cluster genes by expression patterns

    • Perform Gene Ontology (GO) enrichment analysis

    • Map differentially expressed genes to known pathways

    • Identify transcription factor binding motifs in promoters

This approach has successfully revealed specific regulation patterns that highlight phenotypic differences in signaling mutants of S. commune . For BAR1 specifically, this methodology can identify both direct targets and downstream effectors of receptor activation, providing a comprehensive view of the receptor's signaling network.

What culture conditions are optimal for studying BAR1 function in laboratory settings?

Optimizing culture conditions is essential for reliable BAR1 functional studies. Based on established protocols, the following conditions are recommended:

Basic Growth Medium:

  • Schizophyllum commune Minimal Medium (SCMM) provides consistent results

  • For solid culture, supplement with 1.5% agar

  • Maintain at 30°C for routine cultivation

For Developmental Studies:

  • Induce fruiting body formation by growing cultures at 25°C in a 16/8 hours day/night cycle for 7 days

  • For mating experiments, inoculate compatible strains 5 mm apart on SCMM and incubate under the same conditions

Selection Media:

  • For transformant selection, supplement SCMM with appropriate antibiotics:

    • Nourseothricin: 15 μg/mL

    • Phleomycin: 25 μg/mL

Strain Maintenance:

  • Maintain stocks as small agar inocula at 4°C for short-term storage

  • For long-term preservation, store mycelia in 15% glycerol at -80°C

RNA Extraction Conditions:

  • For expression analysis, harvest mycelia at precisely defined developmental stages

  • Flash-freeze samples in liquid nitrogen immediately after collection

  • Process using RNeasy Plant Mini Kit following manufacturer's protocols

These standardized conditions ensure reproducibility and enable meaningful comparisons across different experimental setups.

What are the common challenges in expressing and purifying recombinant BAR1 and how can they be addressed?

Expressing and purifying recombinant BAR1 presents several technical challenges due to its nature as a membrane-bound G protein-coupled receptor. Based on experiences with similar proteins, these challenges and solutions include:

ChallengePotential Solutions
Low expression levels- Use codon-optimized sequences for the expression host
- Test different promoters (constitutive vs. inducible)
- Create fusion proteins with well-expressed tags
- Optimize growth and induction conditions
Protein misfolding- Express in eukaryotic systems (P. pastoris, S. cerevisiae)
- Include molecular chaperones as co-expression partners
- Reduce expression temperature to slow folding
- Use mild detergents during extraction
Toxicity to host cells- Use tightly controlled inducible promoters
- Express as inactive mutants if toxicity is due to signaling
- Consider cell-free expression systems
Membrane extraction- Screen multiple detergents (DDM, CHAPS, digitonin)
- Use detergent mixtures for better solubilization
- Apply gentle extraction conditions to maintain structure
Protein instability- Include stabilizing ligands during purification
- Add cholesterol or other lipids to mimic native membrane
- Perform purification at 4°C
- Use protease inhibitor cocktails

For S. commune specifically, transformation using vectors with C-terminal epitope tags (myc or His) under control of appropriate promoters has been successful. Verification should include both western blotting and functional assays to confirm proper expression and activity .

How can receptor-ligand interactions be studied for BAR1 and its cognate pheromones?

Investigating BAR1-pheromone interactions requires specialized approaches to capture these specific molecular interactions. Based on methodologies applied to similar fungal pheromone receptors, the following techniques are recommended:

  • Binding Assays:

    • Radioligand binding using [³H] or [¹²⁵I]-labeled synthetic pheromones

    • Fluorescence-based binding assays with labeled pheromones

    • Surface Plasmon Resonance (SPR) with purified receptor in nanodiscs

  • Functional Response Measurements:

    • MAPK pathway activation monitoring using phospho-specific antibodies

    • cAMP accumulation assays (BAR1 activation involves cAMP signaling)

    • Calcium flux measurements using fluorescent indicators

    • Transcriptional reporter assays for downstream gene activation

  • Structural Approaches:

    • Computational modeling based on GPCR structural templates

    • Mutagenesis studies targeting predicted binding pocket residues

    • Cryo-electron microscopy of receptor-ligand complexes (challenging but increasingly feasible)

  • In vivo Compatibility Testing:

    • Mating assays between strains with modified BAR1 or pheromone genes

    • Microscopic analysis of hyphal fusion and dikaryotization

    • Quantification of fruiting body formation efficiency

  • Heterologous Expression Systems:

    • Express BAR1 in S. cerevisiae with engineered pheromone response reporters

    • Use mammalian cell lines with appropriate G protein coupling for signaling readouts

These approaches can be combined to build a comprehensive understanding of the molecular determinants governing BAR1-pheromone recognition and subsequent signaling activation. The data from these assays can inform structure-function relationships and potentially guide protein engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.