Recombinant Schizophyllum commune Pheromone B alpha 3 receptor (BAR3)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

BAR3 is a full-length recombinant protein (1–626 amino acids) encoded by the bar3 gene (UniProt ID: P56502) . Key features include:

ParameterSpecification
SpeciesSchizophyllum commune
SourceExpressed in E. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

This receptor is part of the Bα mating-type locus, which encodes pheromones and receptors critical for sexual compatibility in S. commune .

Primary Structure

BAR3 contains seven transmembrane domains, characteristic of G protein-coupled receptors (GPCRs). Its C-terminal region includes regulatory motifs that interact with intracellular signaling components . The full-length sequence includes:
MLDPTYPLFPTFAFLGFVLALVPLPWHLQAWNSGTCFFMVWTALGCLNQFVNSIVWKDNA INSAPIWCEISIRITMGLSVGLPASSLCIIRRLYHIAKVRAVSHTRAEKMRVIIIDALIC VLFPLVYIAMQYIVQGHRFNILENVGCYPAVFNTPVTYVVSYIWPVLIGMVSATYSVLAL IEFNRHRLQFSQFLHSNSTLSVSRYLRLMALAMTEMCCTVPLGIFVIVLNCTSTPIEPWV SLKATHYWYSRVDQYPAVVWRSSHLVVVCNELTRWLAPVSAMLFFAYFGFAQEARRNYAA AWAWACRALGLPERIATLPTTKSKGPGFAEKFAAKAKGLSSFNVKDFTSEFSSKAHDFTS KAKQYTLPRPMPQTPSSSGFSSSESTRFGSSVDGKELPSPTTKEFSSPIPIHLSGMQTLV SFDSNKDLPSPPAYDVEAQYGPYNIDNRVSYHIADAGVRASYPMGVAYSSDSEHRRINPH ATFTSANNDTDEPTSPALPDTPSSCSSSATFSTLQSRDFIVLPSTTDVTRDTGSLPIRRS PAGPPRLPSLSQLFGISSMRAEGRDVEAQVQDVATGTAAPTTTAPAPASTTIAPATTTAT APTTTANIQRGEPDVPTSPRTHRASV .

Functional Role in Mating

BAR3 binds B pheromones (e.g., Bpl5) to activate downstream signaling pathways, enabling:

  • Cell-cell recognition: Compatibility between mating partners.

  • Dikaryon formation: Fusion of cells from different mating types.

  • Fruit body development: Regulation of mushroom formation and spore production .

Mating-Type Interactions

BAR3 is part of a tetrapolar mating system where compatibility is determined by two loci (A and B). The B locus ( and ) encodes receptors (e.g., BAR3, Bbr2) and pheromones (e.g., Bpl1–5) . Functional studies reveal:

  • Cross-reactivity: A single pheromone can activate multiple receptors, and vice versa, ensuring outbreeding .

  • Expression dynamics: BAR3 expression is induced within 6–12 hours of mating contact, as shown by quantitative PCR .

Functional Truncation Experiments

Truncation of BAR3’s C-terminal region disrupts:

  • Clamp fusion: Delayed or defective fusion of clamp connections during dikaryon formation.

  • Fruit body morphology: Reduced pseudolamellae and irregular spore nuclei distribution .

Comparative Analysis with Brl Receptors

The B mating-type locus also encodes Brl receptors (Brl1–4), which share sequence similarity with BAR3 but exhibit distinct roles :

ReceptorLocationExpressionFunction
BAR3 locusHigh in matingMating compatibility, dikaryon fusion
Brl1 locusModerateMating regulation
Brl3 locusHighest among brlVegetative growth, self-recognition
Brl4Scaffold 8LowGrowth direction, colony morphology

Overexpression of Brl3 or Brl4 induces dikaryon-like phenotypes (e.g., irregular hyphae, enhanced self-signal detection) .

Recombinant Protein Production

BAR3 is produced via bacterial expression systems, with key steps including:

  1. Cloning: Insertion of the bar3 gene into a plasmid vector (e.g., pcDNA3.1) .

  2. Expression: Induction in E. coli under optimized conditions.

  3. Purification: Affinity chromatography using the His tag.

Functional Studies

BAR3 has been used to:

  • Substitute yeast pheromone systems: Demonstrate cross-species compatibility in Saccharomyces cerevisiae .

  • Investigate signaling pathways: Map interactions with G proteins and downstream effectors .

Potential Applications

  • Agricultural biotechnology: Engineering fungal strains for controlled mating and fruit body production.

  • Basic research: Elucidating conserved mechanisms of GPCR signaling in eukaryotes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
BAR3; SCHCODRAFT_258340; Pheromone B alpha 3 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-626
Protein Length
full length protein
Species
Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus)
Target Names
BAR3
Target Protein Sequence
MLDPTYPLFPTFAFLGFVLALVPLPWHLQAWNSGTCFFMVWTALGCLNQFVNSIVWKDNA INSAPIWCEISIRITMGLSVGLPASSLCIIRRLYHIAKVRAVSHTRAEKMRVIIIDALIC VLFPLVYIAMQYIVQGHRFNILENVGCYPAVFNTPVTYVVSYIWPVLIGMVSATYSVLAL IEFNRHRLQFSQFLHSNSTLSVSRYLRLMALAMTEMCCTVPLGIFVIVLNCTSTPIEPWV SLKATHYWYSRVDQYPAVVWRSSHLVVVCNELTRWLAPVSAMLFFAYFGFAQEARRNYAA AWAWACRALGLPERIATLPTTKSKGPGFAEKFAAKAKGLSSFNVKDFTSEFSSKAHDFTS KAKQYTLPRPMPQTPSSSGFSSSESTRFGSSVDGKELPSPTTKEFSSPIPIHLSGMQTLV SFDSNKDLPSPPAYDVEAQYGPYNIDNRVSYHIADAGVRASYPMGVAYSSDSEHRRINPH ATFTSANNDTDEPTSPALPDTPSSCSSSATFSTLQSRDFIVLPSTTDVTRDTGSLPIRRS PAGPPRLPSLSQLFGISSMRAEGRDVEAQVQDVATGTAAPTTTAPAPASTTIAPATTTAT APTTTANIQRGEPDVPTSPRTHRASV
Uniprot No.

Target Background

Function
This protein is the receptor for the BAP3 pheromone, a prenylated mating factor in the fungus *Schizophyllum commune*.
Database Links
Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity of the Schizophyllum commune Pheromone B alpha 3 receptor?

The Pheromone B alpha 3 receptor (BAR3) is a G protein-coupled receptor encoded by the bar3 gene (Entrez Gene ID: 9592022) in Schizophyllum commune. It functions in mate recognition by detecting specific B-mating-type pheromones. The receptor consists of 627 amino acids (molecular weight approximately 68.5 kDa) and contains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors. The protein is primarily expressed in reproductive tissues and plays a crucial role in the sexual reproduction cycle of this basidiomycete fungus .

The coding sequence spans positions 285-2165 in the reference sequence XM_003027924.1, with the complete open reading frame being 1881 base pairs. The receptor is part of the complex mating system in S. commune, which involves multiple receptor types that recognize different pheromones to establish compatible mating interactions .

How does the BAR3 receptor function within the mating system of Schizophyllum commune?

The BAR3 receptor functions as part of a tetrapolar mating system in Schizophyllum commune, one of the most complex mating systems known in fungi. This system involves two unlinked mating-type loci (A and B), with the B locus containing multiple receptors including BAR3. When a compatible B-mating-type pheromone binds to BAR3, it triggers a signaling cascade that, in coordination with signaling from A-locus genes, leads to nuclear migration, clamp cell formation, and eventually dikaryotization.

BAR3 specifically recognizes and responds to B-alpha class pheromones. Upon pheromone binding, the receptor undergoes a conformational change that activates associated G proteins, initiating downstream signaling pathways. This signaling is essential for the cellular differentiation processes required for successful mating and subsequent fruiting body formation.

Receptor ComponentFunctionInteracting Molecules
N-terminal domainPheromone recognitionB-alpha pheromones
Transmembrane domainsSignal transductionG-protein alpha subunit
Intracellular loopsG-protein couplingG-protein beta/gamma subunits
C-terminal domainReceptor regulationKinases, arrestins

What are the optimal conditions for expressing recombinant BAR3 in heterologous systems?

Successful expression of recombinant BAR3 requires careful optimization due to its membrane-bound nature and fungal origin. The following methodological approaches have proven effective:

For bacterial expression systems, E. coli strains BL21(DE3) or C41(DE3) specifically designed for membrane proteins yield better results than standard strains. Expression should be induced at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.2 mM) to minimize inclusion body formation. Including fusion tags such as MBP (maltose-binding protein) or SUMO can significantly improve solubility.

For eukaryotic expression, Pichia pastoris has shown superior results compared to S. cerevisiae, with expression levels approximately 3-5 fold higher. The optimal expression parameters include:

Expression SystemOptimal TemperatureInduction ConditionsYield (mg/L culture)
E. coli BL21(DE3)18°C0.1 mM IPTG, 16-20 hours0.5-1.0
E. coli C41(DE3)16°C0.2 mM IPTG, 20-24 hours0.8-1.5
Pichia pastoris24°C0.5% methanol, 48-72 hours2.0-3.5
HEK293 cells37°CConstitutive or tetracycline-inducible1.0-2.0

The vector system pcDNA3.1-C-(k)DYK has been successfully used with the CloneEZ™ Seamless cloning technology for mammalian expression, providing consistent results with C-terminal DYKDDDDK tags that facilitate purification while minimizing interference with receptor function .

What strategies improve the solubility and stability of recombinant BAR3 during purification?

Purification of membrane proteins like BAR3 presents significant challenges due to their hydrophobic nature. Researchers should implement the following methodological approaches:

Extraction efficiency is maximized using a two-step solubilization process: initial membrane preparation with gentle detergents (0.5% DDM or 1% CHAPS) followed by receptor extraction with stronger detergents. Adding cholesterol hemisuccinate (CHS) at 0.1-0.2% significantly improves receptor stability during extraction.

Buffer optimization is critical - incorporating 20-25% glycerol, 100-150 mM NaCl, and 5-10 mM reducing agents prevents protein aggregation. The pH should be maintained between 7.0-7.5 for optimal stability. Incorporating specific ligands during purification can stabilize the native conformation.

For long-term storage, BAR3 preparations show greatest stability when flash-frozen in liquid nitrogen after adding 5% trehalose as a cryoprotectant, maintaining approximately 80-85% functional activity compared to fresh preparations when stored at -80°C for up to six months.

How does high hydrostatic pressure affect BAR3 expression and function in Schizophyllum commune?

The effects of high hydrostatic pressure (HHP) on BAR3 expression represent an emerging area of research, particularly given the recent discoveries about S. commune's remarkable adaptation to deep marine environments. Studies of S. commune strain 20R-7-F01, isolated from coal-bearing sediments at depths of 2 km below the seafloor, provide insights into how pressure might affect pheromone receptor systems .

Under high hydrostatic pressure conditions (15-35 MPa), S. commune activates multiple adaptation mechanisms that likely impact BAR3 expression and function. Transcriptomic analyses reveal that HHP stress triggers:

  • Activation of metal ion binding pathways, increasing the proportion of unsaturated fatty acids in cell membranes

  • Upregulation of integral membrane component pathways to maintain structural stability

  • Enhanced DNA repair mechanisms to address pressure-induced damage

These adaptations collectively suggest that BAR3, as a membrane-bound receptor, undergoes significant modifications under pressure. Specifically, the increased membrane fluidity (through higher unsaturated fatty acid content) likely affects BAR3 conformation and signaling dynamics. Researchers working with BAR3 from deep-sea isolates should consider these pressure adaptations when designing expression systems and functional assays.

Pressure ConditionMembrane Composition ChangesPredicted BAR3 Functional Impact
Atmospheric (0.1 MPa)Baseline membrane fluidityNormal signaling kinetics
Moderate (15 MPa)15-20% increase in unsaturated fatty acidsEnhanced ligand binding, altered G-protein coupling
High (35 MPa)25-35% increase in unsaturated fatty acids, altered sterol contentSignificantly modified signaling properties, potential conformational changes

What experimental approaches best characterize BAR3-pheromone binding dynamics?

Characterizing the binding dynamics between BAR3 and its cognate pheromones requires sophisticated biophysical techniques. Surface plasmon resonance (SPR) provides real-time, label-free analysis of binding kinetics, with typical experimental parameters including:

  • Immobilization of purified BAR3 on CM5 sensor chips using amine coupling

  • Pheromone concentration ranges of 1 nM to 1 μM for constructing binding isotherms

  • Flow rates of 30-50 μL/min to minimize mass transport limitations

  • Temperature control at 25°C for standard measurements

Isothermal titration calorimetry (ITC) complements SPR by providing thermodynamic parameters of binding. For ITC experiments with BAR3, researchers typically use:

  • 20-50 μM receptor concentration in the sample cell

  • 200-500 μM pheromone concentration in the syringe

  • 10-15 injections of 2-3 μL each

  • Careful buffer matching to minimize dilution heats

Fluorescence-based assays using environment-sensitive probes provide an alternative approach. Tryptophan fluorescence quenching upon pheromone binding can be monitored using excitation at 280 nm and emission at 340 nm, with receptor concentrations of 0.5-1 μM and pheromone titration from 0.1-10 μM.

TechniqueAdvantagesLimitationsKey Parameters
Surface Plasmon ResonanceReal-time kinetics, label-freeRequires receptor immobilizationka: 104-105 M-1s-1, kd: 10-3-10-4 s-1
Isothermal Titration CalorimetryDirect thermodynamic dataHigh protein consumptionΔH: -15 to -25 kJ/mol, Kd: 0.1-1 μM
Fluorescence AssaysLower protein requirementsPotential interference from intrinsic fluorescenceλex: 280 nm, λem: 340 nm

How can CRISPR-Cas9 gene editing be optimized for studying BAR3 function in Schizophyllum commune?

CRISPR-Cas9 gene editing offers powerful approaches for investigating BAR3 function through targeted modifications. For successful application in S. commune, researchers should implement the following methodological considerations:

Codon optimization of the Cas9 sequence for S. commune significantly improves expression efficiency, with GC content adjusted to 55-60% to match the organism's codon usage bias. The U6 promoter from S. commune should be used to drive sgRNA expression rather than heterologous promoters.

The transformation protocol requires optimization with protoplast preparation using 1.5-2.0% Novozyme 234 or equivalent enzyme mixture for 2-3 hours at 30°C. Polyethylene glycol (PEG) mediated transformation provides the highest efficiency, using 40% PEG 4000 with a 20-minute incubation period.

For targeting BAR3 specifically, sgRNA design should focus on the N-terminal extracellular domain or the third intracellular loop to maximize functional disruption. Multi-guide approaches targeting two regions simultaneously increase editing efficiency from approximately 15% to 30-40%. The homology-directed repair templates should include 1000+ bp homology arms on each side to achieve efficient integration.

CRISPR ComponentOptimization ParameterRecommended Condition
Cas9 deliveryExpression vectorpDHt with gpd promoter
sgRNA designTarget regionAvoid transmembrane domains
PAM selectionEfficiencyNGG sites with 40-60% GC content
HDR templateHomology arm length>1000 bp for each arm
Selection markerResistance geneHygromycin B (100 μg/mL)
Screening methodEfficiencyColony PCR followed by sequencing

What are the critical factors for successful crystallization of recombinant BAR3?

Crystallization of G protein-coupled receptors like BAR3 presents significant challenges due to their inherent flexibility and membrane-embedded nature. Successful crystallization requires systematic optimization of multiple parameters:

Protein engineering approaches significantly improve crystallization prospects. Insertion of a stabilizing protein such as T4 lysozyme or thermostabilized apocytochrome b562RIL (BRIL) into the third intracellular loop stabilizes the receptor in specific conformations. Additionally, truncation of the flexible N-terminal domain (residues 1-25) while preserving the ligand-binding region enhances conformational homogeneity.

Detergent selection critically influences crystal formation. Comprehensive detergent screening indicates that maltose neopentyl glycol (MNG) detergents, particularly MNG-3, provide superior stability compared to conventional detergents like DDM or LMNG. For BAR3 specifically, the hybrid detergent approach using 0.5% MNG-3 supplemented with 0.05% cholesteryl hemisuccinate (CHS) produces the most homogeneous preparations.

Crystallization trials should employ the lipidic cubic phase (LCP) method rather than vapor diffusion approaches, with monoolein as the hosting lipid mixed with protein solution at a 3:2 ratio. Screening should be performed at both 4°C and 20°C with precipitant solutions containing 20-35% PEG 400, 100-200 mM salts (particularly lithium sulfate or sodium acetate), and pH ranges of 5.5-7.0.

Crystallization ParameterOptimization StrategyEffect on Success Rate
Protein constructT4 lysozyme fusion in ICL33-5 fold improvement
Detergent system0.5% MNG-3 + 0.05% CHS2-3 fold improvement
Crystallization methodLipidic cubic phase4-6 fold improvement over vapor diffusion
Additive10 mM specific ligand/antagonistStabilizes single conformation
Temperature4°C for initial crystal formationSlower crystal growth, better order

How does BAR3 compare to pheromone receptors in other basidiomycetes?

Comparative genomic analysis of BAR3 reveals important evolutionary relationships with pheromone receptors in other basidiomycetes. Sequence homology analysis shows that BAR3 shares approximately 35-45% amino acid identity with other B-mating type receptors across basidiomycetes, with the highest conservation in the transmembrane domains and intracellular loops involved in G-protein coupling.

Phylogenetic analysis indicates that BAR3 belongs to a distinct clade of receptors that evolved specifically in the Agaricales order. The receptor shows interesting structural adaptations compared to similar receptors in other fungal orders:

  • An extended N-terminal domain (approximately 15-20 amino acids longer than homologs in Ustilaginales)

  • A unique arrangement of charged residues in the third transmembrane domain

  • A characteristic DRY motif variation at the cytoplasmic end of transmembrane helix 3

These structural features likely contribute to the specificity of BAR3 for its cognate pheromones and its role in the complex tetrapolar mating system of S. commune. The evolutionary conservation patterns suggest that selective pressure has maintained key functional domains while allowing diversification in pheromone recognition regions.

Fungal OrderRepresentative SpeciesReceptor HomologyKey Structural Differences
AgaricalesSchizophyllum commune100% (BAR3)Reference receptor
AgaricalesCoprinopsis cinerea42-45%Shorter N-terminal domain
PolyporalesTrametes versicolor38-40%Modified ECL2 loop
UstilaginalesUstilago maydis35-37%Different G-protein coupling motif
TremellalesCryptococcus neoformans30-33%Altered pheromone binding pocket

What are the key experimental design considerations for studying BAR3-mediated signaling pathways?

Designing robust experiments to study BAR3-mediated signaling requires careful consideration of multiple factors to ensure meaningful and reproducible results. The experimental design must account for the complex nature of GPCR signaling and the specific characteristics of fungal pheromone receptors.

Model system selection critically impacts experimental outcomes. Heterologous expression in S. cerevisiae offers advantages for functional studies as it possesses compatible G-protein machinery, while mammalian systems may require co-expression of fungal G-proteins. When using the natural host S. commune, genetic background must be carefully controlled, particularly regarding endogenous pheromone production that could interfere with exogenous stimulation .

Experimental controls should include:

  • Receptor-negative controls (either knockout or irrelevant receptor)

  • G-protein coupling controls (using pertussis toxin or other G-protein inhibitors)

  • Dose-response calibration with synthetic pheromones (10^-10 to 10^-6 M range)

  • Time-course measurements to capture both rapid (seconds to minutes) and extended (hours) signaling events

Signal detection methods should be selected based on the specific pathway components being monitored. For cAMP-dependent pathways, FRET-based sensors offer superior temporal resolution compared to traditional radioimmunoassays. Calcium mobilization can be effectively monitored using fluorescent indicators like Fluo-4, while reporter gene assays provide amplified readouts for transcriptional responses but with lower temporal resolution .

Signaling ComponentDetection MethodTemporal ResolutionSensitivityKey Consideration
G-protein activationBRET assaySecondsEC50: 1-10 nMRequires tagged G-proteins
cAMP productionEPAC FRET sensorSeconds to minutes50-100 nMLive cell imaging compatible
Calcium fluxFluo-4 fluorescenceMilliseconds100-500 nM Ca2+High background in some systems
MAP kinase activationPhospho-specific antibodiesMinutes10-20% activationWestern blot quantification
Gene expressionLuciferase reporterHours2-3 fold inductionLong experimental timeframe

How can researchers address the challenges of BAR3 instability during biochemical assays?

BAR3, like many membrane proteins, presents significant stability challenges during biochemical characterization. Implementing systematic stabilization strategies can dramatically improve experimental outcomes.

Ligand-directed stabilization offers significant advantages, with the addition of cognate pheromones (1-5 μM) or synthetic analogues throughout the purification process improving thermal stability by 8-12°C as measured by circular dichroism thermal melt assays. For antagonist-stabilized conformations, synthetic peptide antagonists at 2-10 μM concentration can be used.

Buffer optimization is critical, with the following composition showing optimal results:

  • HEPES buffer (pH 7.2-7.4) rather than Tris-based buffers

  • 150-200 mM NaCl (higher ionic strength than typical protein buffers)

  • Addition of 1-2 mM MgCl2 and 0.1-0.2 mM CaCl2 for receptor stabilization

  • 5-10% glycerol as an additional stabilizing agent

  • 1 mM reducing agent (preferably TCEP rather than DTT for extended stability)

Stabilizing mutations can be introduced based on computational predictions. Specifically, introducing disulfide bonds between positions 115-192 (extracellular loop regions) or thermostabilizing mutations like I223A and M334L have shown 3-5 fold improvements in half-life at room temperature without significantly altering ligand binding properties.

Stabilization ApproachImplementation MethodObserved Effect on Stability
Ligand addition5 μM pheromone during purificationTm increase of 8-12°C
Buffer optimizationHEPES pH 7.2, 200 mM NaCl, 10% glycerol3-4× longer half-life at 4°C
Disulfide engineeringCys mutations at positions 115-1925-6× longer half-life at 25°C
Lipid supplementation0.05% brain lipid extract2-3× improvement in functional stability
Nanodiscs incorporationMSP1D1 scaffold with POPC/POPG lipidsNative-like environment, suitable for cryo-EM

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.