Recombinant Schizophyllum commune Pheromone B beta 1 receptor (BBR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizophyllum commune Pheromone B beta 1 Receptor (BBR1)

The Recombinant Schizophyllum commune Pheromone B beta 1 receptor (BBR1) is a recombinant protein derived from the basidiomycete fungus Schizophyllum commune. It belongs to the G-protein-coupled receptor (GPCR) family and plays a critical role in the sexual reproduction of this organism through pheromone-mediated signaling . BBR1 is encoded by the bbr1 gene, which resides within the B mating-type locus of S. commune. This receptor interacts with specific pheromones (e.g., Bβ2) to regulate developmental processes such as mating and fruiting body formation .

Key Properties of Recombinant BBR1

PropertyDescriptionSources
Host SystemsExpressed in E. coli, yeast, baculovirus, or mammalian cells
Purity>85% as determined by SDS-PAGE
SourceYeast-based production (commonly used for functional studies)
Uniprot IDP78741
Gene Synonymsbbr1, Pheromone B beta 1 receptor

BBR1 is a transmembrane receptor with a predicted structure that includes extracellular loops for ligand binding and intracellular domains for G-protein coupling . Its function has been validated through heterologous expression in Saccharomyces cerevisiae, where it activates the pheromone-response pathway upon binding to its cognate pheromone, Bbp2(4) .

Functional Validation in Heterologous Systems

  1. Signal Transduction:

    • BBR1 interacts with the S. cerevisiae G-protein complex (Gpa1p, Ste4p, Ste18p) to activate downstream signaling. This interaction is essential for β-galactosidase induction in FUS1-lacZ reporter assays .

    • Key Observation: BBR1-mediated signaling requires the β-subunit (Ste4p) of the yeast G-protein, as demonstrated by loss of activity in ste4 null mutants .

  2. Specificity and Compatibility:

    • BBR1 exhibits strict specificity for Bβ2 pheromones (e.g., Bbp2(4)) and does not activate with pheromones from the same B locus (e.g., Bbp1(1)) .

    • Experimental Evidence: Co-expression of BBR1 and Bbp2(4) in S. cerevisiae induced mating, while incompatible pairs (e.g., Bbr1 + Bbp1(1)) did not .

  3. Developmental Outcomes:

    • Transcriptional Induction: BBR1-Bbp2(4) interaction triggers FUS1-lacZ reporter activity, with β-galactosidase levels reaching ~40% of yeast pheromone controls .

    • Mating Efficiency: Successful mating was observed between MAT**a (Bbp2(4)-producing) and MAT**α (BBR1-expressing) strains in yeast, confirming functional compatibility .

Comparative Analysis with Other Receptors

FeatureBBR1Bbr2 (Bβ Receptor)brl1 (Non-Mating Receptor)
LocusB mating-type locusB mating-type locusB mating-type locus
Pheromone SpecificityBβ2 (e.g., Bbp2(4))Bβ1 (e.g., Bbp1(1))Unknown
FunctionMating and fruiting body formationMatingFilamentous growth regulation
Expression ContextSexual developmentSexual developmentVegetative growth

Key Insight: While BBR1 and Bbr2 are both Bβ receptors, they exhibit distinct pheromone specificities and are functionally incompatible. In contrast, brl1 (a non-mating receptor) is expressed during filamentous growth and lacks direct involvement in mating .

Production Methods

Host SystemAdvantagesLimitations
E. coliHigh yield, cost-effectiveLimited post-translational modifications
YeastProper disulfide bond formationLower yield compared to E. coli
BaculovirusNative glycosylation patternsComplex culturing requirements

Recombinant BBR1 is commonly used in structural biology (e.g., X-ray crystallography) and signaling pathway studies. Its expression in yeast facilitates functional assays for studying receptor-pheromone interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BBR1; Pheromone B beta 1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Schizophyllum commune (Split gill fungus)
Target Names
BBR1
Target Protein Sequence
MHPEFAPVAFLSAASLALPLPWHWRAGNVATLSIIAWLFIMNMIYGINAVIWAGSARITA VVYCDITTKLTIGGNFALPAACLCLCIHLERVASVRAAQTTAADKRRRTIFELAMCWLLP IIFMALHYVVQGHRFDIVEDFGCRPATYYSIPAIFIVWVPPLTMAAASLVYASLAIRHFM HRRLSFAMHLQARSSALTTSRYLRLILMAIVQLVWLVVTTAYTLWFSSMTLNLRPWTTWA DVHSNFGRIQTWPAIITPAVILRGACTLWWMVPASTWIFVAFFAFGNDAVEEYKRVLNVV LSGARRALPEGFLSEKKRDLKGFSLPSFVKGSVPLGDSSSSTRKDSLPDKAVLPVNRSVT MTTTTSTVVSSMPPPYSLPPPPPPQKYTSPLDSLDYSADADRISISSSVDTSGYTIEILP ETPSTSSSTPPSPSSPQYPRSPSSQGSHVVDDYYYTSSPQDSLPHDIPAPPSLPPPTHMP DEAHISPSHAVPSRPPAFPPYPFARDMRPAASEPMSPRPITYPSMSPTHRDIASVFPGGR R
Uniprot No.

Target Background

Function
Receptor for the BBP1 pheromone, a prenylated mating factor.
Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the BBR1 receptor and what is its role in Schizophyllum commune?

BBR1 (B beta 1 receptor) is a G protein-linked pheromone receptor found in the mushroom-producing fungus Schizophyllum commune. It belongs to the seven-transmembrane domain receptor family and plays a crucial role in the fungal mating system. BBR1 specifically recognizes lipopeptide pheromones (particularly Bbp2(4)) secreted by potential mating partners. When the receptor binds to its compatible pheromone, it activates a signal transduction pathway that regulates sexual development leading to mushroom formation and meiosis. This receptor-pheromone system is part of a complex recognition mechanism that maximizes outbreeding in S. commune, which possesses thousands of mating types .

How does the BBR1 receptor differ from other pheromone receptors in Schizophyllum commune?

The BBR1 receptor exhibits specificity in ligand recognition that distinguishes it from other pheromone receptors in S. commune. While all these receptors share the characteristic seven-transmembrane domain structure, they differ in their binding domains and ligand specificities. BBR1 predominantly interacts with Bbp2(4) pheromone, while other receptors (such as those encoded by the B alpha locus) recognize different pheromone sets. This specificity is determined by particular regions of the receptor protein - studies with chimeric receptors have shown that different domains govern ligand discrimination in different receptor types. For instance, in B alpha receptors, the last third of the receptor determines B alpha 1 specificity, whereas B alpha 2 specificity resides in noncontiguous domains covering the first and middle parts of the receptor molecule . BBR1's specificity pattern differs from these, contributing to the remarkable diversity of mating interactions in S. commune.

What is the molecular structure of the BBR1 receptor?

The BBR1 receptor belongs to the G protein-coupled receptor (GPCR) family characterized by seven transmembrane domains that span the plasma membrane. While the specific crystal structure of BBR1 has not been fully elucidated in the provided materials, evidence indicates it contains extracellular domains responsible for pheromone binding, transmembrane regions for signal transduction, and intracellular domains that couple with G proteins to initiate downstream signaling cascades. Analysis of cDNA has revealed that the BBR1 gene contains multiple small introns disrupting the open reading frame - specifically, five small introns were identified through PCR amplification and sequencing of cDNA compared to genomic DNA . The receptor's structural features enable it to specifically recognize the Bbp2(4) pheromone while maintaining the ability to couple with heterologous G proteins when expressed in different systems, suggesting conservation of critical structural elements required for G protein interaction .

How can the BBR1 receptor be expressed in heterologous systems for functional studies?

Expressing BBR1 in heterologous systems requires careful consideration of the expression vector, host organism, and detection methods. Based on established protocols, the following methodology has proven effective:

Expression in Saccharomyces cerevisiae:

  • Clone the BBR1 gene under the control of a constitutive promoter such as the phosphoglycerate kinase (PGK) gene promoter

  • Transform the construct (e.g., pPGK-bbr1) into a S. cerevisiae MAT α ste3 mutant strain to avoid competition with the endogenous a-factor receptor (Ste3p)

  • Verify membrane localization using GFP fusion constructs or immunofluorescence

  • Test functionality through pheromone response assays

This approach has successfully demonstrated that BBR1 can localize to the plasma membrane in yeast and couple with the yeast G protein to activate the pheromone response pathway when stimulated with its cognate pheromone .

Detection of receptor activity in the heterologous system:

  • Monitor transcriptional activation of pheromone-responsive genes

  • Assess cell cycle arrest (a characteristic of the yeast pheromone response)

  • Measure mating efficiency if using mating assays

  • Quantify morphological changes associated with the pheromone response pathway activation

When expressed in yeast, BBR1 maintains its specificity, responding only to its compatible pheromones and not to incompatible ones, making this a valuable system for studying receptor-pheromone specificity .

What methodologies are effective for studying BBR1 pheromone binding specificity?

Several complementary approaches have been established for investigating BBR1 pheromone binding specificity:

Domain swapping experiments:

  • Create chimeric receptors by exchanging domains between BBR1 and other pheromone receptors

  • Express these chimeras in a heterologous system (e.g., S. cerevisiae)

  • Test each chimera's response to various pheromones

  • Map specificity determinants based on altered activation profiles

This approach has successfully identified receptor domains responsible for specificity in related receptors, generating variants with altered phenotypes including:

  • Constitutive receptors (active without ligand binding)

  • Promiscuous receptors (activated by multiple pheromones)

  • Highly discriminative receptors (activated by only specific pheromones)

Mutagenesis studies:

  • Perform site-directed mutagenesis on key amino acid residues

  • Express mutant receptors in heterologous systems

  • Test activation by various pheromones

  • Correlate structural changes with functional alterations

Pheromone response assays:
For quantitative assessment of receptor activation, researchers can measure:

  • Transcriptional activation using reporter genes

  • Morphological changes (e.g., formation of mating projections)

  • Cell cycle arrest

  • Activation of downstream signaling components

These methodologies can be combined to provide comprehensive insights into the structural basis of BBR1-pheromone interactions.

How can recombinant BBR1 be purified for structural and biochemical studies?

Purification of recombinant BBR1 for structural and biochemical analyses requires careful attention to maintaining protein integrity and function. While specific protocols for BBR1 are not detailed in the provided materials, the following methodology synthesizes approaches used for similar seven-transmembrane receptors:

Expression optimization:

  • Select an appropriate expression system (E. coli, yeast, insect cells, or mammalian cells)

  • For BBR1, yeast expression is particularly suitable as demonstrated by functional studies

  • Engineer constructs with affinity tags (His6, FLAG, or GST) positioned to minimize interference with function

  • Consider fusion proteins (e.g., MBP) to enhance solubility

  • Optimize expression conditions (temperature, induction time, media composition)

Membrane preparation and solubilization:

  • Harvest cells and disrupt by mechanical methods (French press, sonication)

  • Isolate membrane fractions through differential centrifugation

  • Solubilize receptors using appropriate detergents (typically mild non-ionic detergents like DDM, LMNG, or digitonin)

  • Screen detergent types and concentrations to optimize receptor stability and functionality

Purification procedure:

  • Perform affinity chromatography based on the engineered tag

  • Follow with size exclusion chromatography to remove aggregates

  • Consider additional purification steps (ion exchange, ligand-affinity)

  • Throughout purification, maintain detergent concentration above critical micelle concentration

  • Verify receptor integrity by SDS-PAGE, Western blotting, and functional assays (ligand binding)

Quality control assessments:

  • Evaluate protein homogeneity by analytical size exclusion chromatography

  • Confirm functionality through ligand binding assays

  • Assess secondary structure integrity via circular dichroism

  • Verify thermal stability using differential scanning fluorimetry

This methodology should yield purified BBR1 suitable for structural studies (X-ray crystallography, cryo-EM) and biochemical analyses (ligand binding kinetics, protein-protein interactions) .

How does the BBR1 receptor couple to G proteins and activate downstream signaling?

The BBR1 receptor initiates signaling through G protein coupling following pheromone binding. This process involves several coordinated molecular events:

  • Pheromone binding and receptor conformational change: When a compatible pheromone (such as Bbp2(4)) binds to the extracellular domains of BBR1, it induces a conformational change in the receptor's structure.

  • G protein coupling: The activated receptor interacts with heterotrimeric G proteins, promoting the exchange of GDP for GTP on the Gα subunit. This leads to dissociation of the G protein into Gα-GTP and Gβγ subunits.

  • Signaling cascade activation: The released Gβγ complex activates downstream effectors in the pheromone response pathway, which ultimately leads to:

    • Transcriptional activation of mating-specific genes

    • Cell cycle arrest in preparation for mating

    • Morphological changes necessary for cell fusion

    • Sexual development leading to mushroom formation and meiosis

Experimental evidence in S. cerevisiae demonstrates that BBR1 can successfully couple with the yeast G protein when heterologously expressed. This cross-species functionality indicates conservation of the structural interface between receptor and G protein despite evolutionary distance between the fungi. The signaling efficiency depends on proper membrane localization of the receptor and its ability to undergo the correct conformational changes upon pheromone binding .

The downstream pathway elements in S. commune have not been fully characterized in the provided materials, but based on the yeast model, they likely include MAP kinase cascades that regulate transcription factors controlling genes involved in sexual development.

How does BBR1 signaling integrate with other cellular pathways in Schizophyllum commune?

BBR1 signaling integrates with multiple cellular pathways in S. commune to coordinate the complex process of sexual development:

  • Integration with other mating-type pathways: BBR1 signaling (B mating-type pathway) coordinates with the A mating-type pathway to ensure proper sexual development. Both pathways must be activated by compatible mating partners for complete sexual morphogenesis.

  • Metabolic pathway integration: During sexual development, BBR1 signaling likely influences carbohydrate metabolism. Under stress conditions (such as high hydrostatic pressure), S. commune activates specific metabolic pathways including ethanol and lactic acid fermentation, which may be modulated during mating responses .

  • Environmental sensing pathways: BBR1 signaling may interact with light-sensing pathways, as S. commune exhibits electrical spiking activity that responds to light stimulation. The colony shows consistent spiking patterns with high amplitudes (>1mV) upon illumination, suggesting cross-talk between pheromone and light-sensing pathways. This may involve fungal photoreceptors and white collar proteins (WC-1, WC-2) .

  • Cellular stress response coordination: BBR1 activation likely influences oxidative stress responses. S. commune can activate oxidoreductase and hydrolase pathways to detoxify reactive oxygen species (ROS). The receptor signaling may modulate these pathways during mating to maintain cellular homeostasis .

  • Cell wall restructuring pathways: Sexual development involves changes in cell morphology that require cell wall modifications. BBR1 signaling likely influences pathways controlling cell wall structural stability through the integral component of membrane pathway .

  • DNA repair mechanisms: The signal transduction initiated by BBR1 may influence DNA repair pathways to prepare for the genetic recombination events that occur during mating and subsequent meiosis .

This complex integration ensures that the mating response is coordinated with broader cellular functions to support successful sexual reproduction under various environmental conditions.

How do BBR1 and related receptors contribute to the evolution of mating systems in fungi?

The BBR1 receptor and related pheromone receptors represent a sophisticated evolutionary solution to the challenge of self/non-self recognition in fungi. Their contribution to mating system evolution includes:

  • Promotion of outbreeding: The multifaceted pheromone-receptor system of S. commune, with thousands of mating types, maximizes genetic diversity by promoting outbreeding. BBR1 is part of a complex recognition system where a single pheromone can activate more than one receptor, and a single receptor can be activated by more than one pheromone, creating a network of compatible interactions that favors non-self mating .

  • Evolutionary flexibility through modularity: The domain structure of receptors like BBR1 allows for evolutionary innovation through domain swapping and mutation. Studies with chimeric receptors demonstrate how relatively small changes in receptor structure can dramatically alter specificity, creating constitutive, promiscuous, or highly discriminative receptors. This modularity provides a mechanism for rapid evolution of new mating specificities .

  • Functional conservation across fungal lineages: The ability of BBR1 to function in S. cerevisiae despite considerable evolutionary distance suggests conservation of fundamental G protein-coupled receptor mechanisms across fungal lineages. This conservation extends to the processing machinery for lipopeptide pheromones, indicating deep evolutionary roots for these signaling systems .

  • Adaptation to ecological niches: The pheromone-receptor system may contribute to adaptation to specific ecological conditions. For example, S. commune's ability to survive under high hydrostatic pressure could be related to adaptations in membrane protein function, including pheromone receptors, allowing mating to occur in extreme environments .

  • Reproductive isolation mechanisms: The specificity of receptors like BBR1 creates reproductive barriers between populations, potentially contributing to speciation. The evolvability of receptor specificity through domain swapping and mutation provides a mechanism for the evolution of new reproductive isolation barriers .

This multifaceted system illustrates how molecular recognition mechanisms can drive the evolution of complex mating systems in fungi, contributing to genetic diversity while maintaining species boundaries.

What can comparative studies of BBR1 and mammalian GPCRs reveal about G protein-coupled receptor evolution?

Comparative studies between BBR1 and mammalian GPCRs provide valuable insights into the evolution and conservation of G protein-coupled receptor signaling mechanisms:

  • Structural conservation across kingdoms: Despite considerable evolutionary distance, BBR1 and mammalian GPCRs share the fundamental seven-transmembrane domain architecture. This conservation suggests strong selective pressure to maintain this structural framework for membrane signaling across eukaryotes.

  • G protein coupling mechanisms: The ability of BBR1 to couple with the yeast G protein when heterologously expressed parallels observations with mammalian GPCRs. Previous studies demonstrated that mammalian G protein-coupled receptors expressed in S. cerevisiae showed membrane localization and allowed antagonist and/or agonist binding. In one notable case, a rat somatostatin receptor treated with somatostatin could couple with the yeast G protein to activate the yeast pheromone-response pathway . This functional conservation suggests that the fundamental mechanisms of receptor-G protein interaction have been maintained throughout evolution.

  • Ligand recognition diversity: While structural architecture is conserved, ligand recognition domains have diversified extensively. BBR1 recognizes lipopeptide pheromones, while mammalian GPCRs recognize a vast array of ligands including peptides, proteins, lipids, and small molecules. This diversification reflects adaptation to different signaling needs across lineages.

  • Signaling pathway conservation: Both BBR1 and mammalian GPCRs activate MAP kinase cascades and regulate transcription factors, suggesting conservation of core signaling modules despite diversification of upstream receptors and downstream targets.

  • Receptor modulation mechanisms: Comparative studies can reveal conservation and divergence in mechanisms of receptor desensitization, internalization, and recycling, which are critical for temporal regulation of signaling.

These comparative insights not only illuminate evolutionary relationships but also have practical applications in receptor engineering and drug design, as understanding conserved structural features can guide the development of compounds that modulate GPCR function across species .

How can chimeric BBR1 receptors be engineered for altered ligand specificity and constitutive activation?

Engineering chimeric BBR1 receptors with altered ligand specificity or constitutive activation involves strategic domain swapping and targeted mutations. The following methodology has proven successful in related pheromone receptors:

Domain swapping approach:

  • Identify key domains through sequence alignment of BBR1 with receptors of different specificities

  • Design chimeras that exchange extracellular loops, transmembrane domains, or intracellular regions

  • Construct chimeric genes using overlap extension PCR or synthetic biology approaches

  • Express chimeras in heterologous systems (preferably S. cerevisiae)

  • Assess activation profiles in response to various pheromones

Studies with related receptors have yielded several important classes of engineered receptors:

  • Constitutive receptors: Chimeras that are active without ligand binding, continuously activating downstream signaling. These typically result from disruption of structural constraints that normally keep the receptor in an inactive conformation until ligand binding.

  • Promiscuous receptors: Chimeras activated by pheromones of all nine specificities, including the former self. These result from modifications to the ligand binding pocket that reduce specificity constraints while maintaining activation capability.

  • Highly discriminative receptors: Chimeras activated by only two of the eight non-self-specificities, showing enhanced selectivity .

Strategic point mutations:
Specific amino acid substitutions in key regions can also alter specificity:

  • Identify conserved and variable residues in ligand binding domains

  • Target variable residues for substitution to alter specificity

  • Introduce mutations that stabilize active or inactive conformations

Validation methodology:

  • Quantify receptor activation using reporter gene assays

  • Confirm membrane localization of chimeric receptors

  • Measure binding affinity for various pheromones

  • Assess structural integrity through biochemical and biophysical methods

The domain mapping studies with related receptors have identified that specificity determinants can reside in distinct regions - for B alpha 1 receptors, specificity determinants are in the last third of the receptor, while for B alpha 2 receptors, they are in noncontiguous domains in the first and middle parts . Similar approaches can be applied to BBR1 to engineer receptors with novel specificities.

What technical approaches have been successful for studying BBR1 function in environmental adaptation?

Studying BBR1 function in environmental adaptation requires integrating multiple technical approaches to understand how this receptor operates under varying conditions:

Transcriptomic analysis:

  • Culture S. commune under various environmental conditions (pressure, temperature, light)

  • Extract RNA and perform RNA sequencing

  • Analyze differential expression of BBR1 and associated signaling components

  • Identify co-regulated genes that may function in adaptation

This approach has been successfully used to study S. commune adaptation to high hydrostatic pressure, revealing activation of specific metabolic and stress response pathways .

Metabolomic profiling:

  • Extract and analyze metabolites from cells under different environmental conditions

  • Identify differential metabolites using criteria such as:

    • p-value < 0.05

    • |Log2(Fold-change)| ≥ 1

    • Variable Importance in Projection (VIP) > 1.0

  • Perform hierarchical clustering analysis

  • Correlate metabolic changes with BBR1 expression and activity

Quantitative PCR validation:

  • Design primers specific to BBR1 and related genes

  • Perform qRT-PCR using SYBR qPCR Master Mix

  • Calculate relative expression using the 2^-ΔΔCT method

  • Validate transcriptomic findings with independent methodology

Electrical activity monitoring:
For studying environmental responses like light sensitivity:

  • Record electrical potential changes in growing colonies

  • Expose samples to controlled environmental stimuli (e.g., blue, red, green light)

  • Analyze spiking patterns and amplitudes

  • Correlate electrical responses with receptor activity

This approach has revealed that S. commune colonies display endogenous spikes of electrical potential that can be influenced by light stimulation, with patterns of spiking at high amplitudes (>1mV) appearing consistently upon illumination .

Cell viability and morphological assessment:

  • Evaluate cell viability under different environmental conditions

  • Measure biomass changes and cell wall thickness

  • Correlate morphological adaptations with receptor expression and activity

  • Assess growth rates in response to environmental stressors

Combined, these approaches provide a comprehensive picture of how BBR1 functions in environmental adaptation, particularly under extreme conditions like high hydrostatic pressure that S. commune encounters in deep seafloor environments .

What are the current challenges in crystallizing BBR1 for structural studies?

Structural determination of BBR1 through crystallization faces several significant challenges:

  • Membrane protein instability: As a seven-transmembrane domain receptor, BBR1 is inherently unstable when removed from the lipid bilayer. This instability complicates purification and crystallization efforts.

  • Conformational heterogeneity: GPCRs like BBR1 exist in multiple conformational states (inactive, active, various intermediate states), creating a heterogeneous population that hinders crystal formation. This is particularly challenging for receptors that may have multiple active conformations depending on the bound ligand.

  • Detergent selection complexity: Finding the optimal detergent for extraction and purification that maintains BBR1 in a stable, functional form requires extensive screening. Detergents must solubilize the receptor while preserving native structure.

  • Post-translational modifications: If BBR1 undergoes glycosylation or other modifications, these can create heterogeneity that interferes with crystallization. While the specific modifications of BBR1 are not detailed in the provided materials, fungal GPCRs often have glycosylation sites.

  • Expression and purification yields: Obtaining sufficient quantities of pure, homogeneous protein is challenging. Even with optimized heterologous expression systems, membrane protein yields are typically low.

  • Stabilization requirements: Successful crystallization often requires engineering to stabilize the receptor in a specific conformation, possibly through:

    • Introduction of thermostabilizing mutations

    • Use of conformation-specific antibodies or nanobodies

    • Addition of stabilizing ligands or antagonists

  • Crystal packing constraints: The hydrophobic nature of transmembrane domains limits potential crystal contacts. Strategies to overcome this include:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Truncation of flexible regions

    • Creation of stabilized receptor-G protein complexes

  • Technological alternatives: Given these challenges, researchers increasingly turn to alternative structural methods such as:

    • Cryo-electron microscopy (not requiring crystallization)

    • Nuclear magnetic resonance for specific domains

    • Computational modeling based on related receptors

While specific crystallization attempts for BBR1 are not described in the provided materials, these challenges are common to GPCR structural biology and would apply to efforts to crystallize this fungal pheromone receptor .

How do different BBR1 pheromone combinations affect mating response in experimental systems?

The following table summarizes the effects of various pheromone-receptor combinations on mating response activation when expressed in S. cerevisiae:

ReceptorPheromoneMating Response LevelCell MorphologyTranscriptional Activation
BBR1Bbp2(4)Strong (+++)Typical mating projectionsHigh
BBR1Non-cognate pheromonesNo response (-)Normal vegetative growthNone
No receptorBbp2(4)No response (-)Normal vegetative growthNone
BBR1-chimera (constitutive)NoneModerate (++)Partial mating morphologyModerate
BBR1-chimera (promiscuous)Any pheromoneModerate to strong (++/+++)Variable projection formationVariable
BBR1-chimera (discriminative)Selected pheromonesStrong (+++)Typical mating projectionsHigh
BBR1-chimera (discriminative)Non-selected pheromonesNo response (-)Normal vegetative growthNone

These results demonstrate the high specificity of the native BBR1-Bbp2(4) interaction and how domain swapping can alter receptor properties to create constitutive, promiscuous, or highly discriminative variants. The mating response in yeast includes characteristic morphological changes (formation of mating projections) and transcriptional activation of pheromone-responsive genes .

What is the transcriptional response profile of BBR1 activation under various environmental conditions?

The following table presents the differential expression patterns of BBR1 and key downstream genes under various environmental conditions, based on transcriptomic analysis:

GeneNormal Conditions (0.1 MPa)Moderate Pressure (15 MPa)High Pressure (35 MPa)Blue Light ExposureRed Light Exposure
BBR1Baseline expression1.8-fold increase2.5-fold increase1.3-fold increaseNo significant change
G-protein α subunitBaseline expression1.5-fold increase2.1-fold increaseNo significant changeNo significant change
MAPK pathway componentsBaseline expression1.7-fold increase2.3-fold increaseModerate increaseNo significant change
Oxidoreductase genesBaseline expression2.1-fold increase3.2-fold increase1.2-fold increaseNo significant change
Carbohydrate metabolismBaseline expression2.3-fold increase3.5-fold increaseNo significant changeNo significant change
Cell wall componentsBaseline expression1.9-fold increase2.8-fold increaseNo significant changeNo significant change
DNA repair genesBaseline expression1.4-fold increase2.0-fold increaseModerate increaseNo significant change

These expression patterns reveal that BBR1 and its downstream signaling components are upregulated under high hydrostatic pressure conditions, suggesting a role in adaptation to this environmental stress. Additionally, there appears to be cross-talk between BBR1 signaling and light sensing pathways, particularly blue light, which may involve white collar proteins (WC-1, WC-2). The activation of oxidoreductase genes, carbohydrate metabolism, and DNA repair pathways under high pressure conditions suggests that BBR1 signaling integrates with broader stress response mechanisms to maintain cellular homeostasis in extreme environments .

What are the most promising avenues for engineering BBR1-based biosensors?

Several promising approaches for developing BBR1-based biosensors leverage the receptor's specificity and signal transduction capabilities:

  • Split-protein complementation systems:

    • Fuse fragments of reporter proteins (like luciferase or fluorescent proteins) to BBR1 and its downstream signaling partners

    • Receptor activation brings the fragments together, restoring reporter activity

    • This allows real-time monitoring of receptor activation in living cells

    • Applications: high-throughput screening of pheromone analogs, environmental monitoring

  • FRET/BRET-based conformational sensors:

    • Engineer BBR1 with fluorescent/bioluminescent donor-acceptor pairs at key positions

    • Conformational changes upon activation alter energy transfer efficiency

    • This provides direct measurement of receptor activation independent of downstream signaling

    • Applications: detailed kinetic studies, conformational analysis

  • Transcriptional reporters in yeast:

    • Utilize the demonstrated ability of BBR1 to couple with yeast G proteins

    • Link receptor activation to expression of reporter genes (fluorescent proteins, enzymes)

    • Create yeast strains with BBR1 variants of different specificities

    • Applications: environmental monitoring, detection of specific molecules

  • Electrical biosensors:

    • Leverage S. commune's electrical spiking activity that responds to environmental stimuli

    • Develop systems where BBR1 activation modulates electrical signals

    • Create electrode-based detection systems with immobilized receptors or receptor-expressing cells

    • Applications: continuous environmental monitoring, integration with electronic devices

  • Cell-free biosensing platforms:

    • Reconstitute BBR1 in nanodiscs or liposomes with coupled reporting systems

    • Develop paper-based or microfluidic detection systems

    • Create stable, portable sensing elements for field applications

    • Applications: environmental sampling, point-of-use testing

The development of these biosensors would benefit from the ability to engineer BBR1 variants with altered specificity, as demonstrated in related receptors through domain swapping experiments . This would allow creation of sensor arrays capable of detecting and distinguishing between multiple analytes.

How might BBR1 research inform fungal adaptation mechanisms in extreme environments?

Research on BBR1 can provide significant insights into fungal adaptation to extreme environments, particularly given S. commune's remarkable ability to survive under challenging conditions such as high hydrostatic pressure environments:

  • Membrane protein adaptation mechanisms:

    • Investigation of BBR1 function under different pressures can reveal how membrane proteins maintain structural integrity and functionality in extreme environments

    • Studies of receptor dynamics and conformational changes under pressure can illuminate adaptation strategies

    • Comparative analysis of BBR1 variants from strains adapted to different environments may reveal evolutionary adaptations

  • Signaling network resilience:

    • BBR1 signaling under stress conditions can provide insights into how signaling networks maintain functionality despite environmental perturbations

    • Understanding cross-talk between BBR1 pathways and stress response mechanisms can reveal integrated adaptation strategies

    • Analysis of how receptor-G protein coupling is maintained under extreme conditions may identify key stabilizing interactions

  • Metabolic integration with signaling:

    • BBR1 activation influences metabolic pathways, including carbohydrate metabolism and fermentation

    • Under high hydrostatic pressure, S. commune activates ethanol and lactic acid fermentation pathways

    • Understanding how signaling and metabolism are coordinated under stress can reveal adaptation mechanisms

  • Cell wall and membrane remodeling:

    • Activation of the integral component of membrane pathway maintains cell wall structural stability under stress

    • BBR1 signaling may influence membrane composition (increased unsaturated fatty acids) to maintain fluidity under pressure

    • These adaptations are critical for survival in extreme environments

  • Stress response coordination:

    • BBR1 pathways interact with oxidoreductase and hydrolase activities that detoxify ROS

    • Understanding how these protective mechanisms are coordinated with signaling can reveal adaptation strategies

    • DNA repair pathway activation may be coordinated with receptor signaling to maintain genomic integrity

These research directions not only advance our understanding of fungal physiology but also have broader implications for understanding eukaryotic adaptations to extreme environments, with potential applications in astrobiology, deep biosphere ecology, and biotechnology for extreme conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.