Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces japonicus Altered Inheritance of Mitochondria Protein 31 (AIM31)

Recombinant Schizosaccharomyces japonicus Altered Inheritance of Mitochondria Protein 31 (AIM31) is a synthetic version of the mitochondrial protein encoded by the aim31 gene in S. japonicus. This protein is hypothesized to play a role in mitochondrial dynamics and inheritance, though its precise biological function remains under investigation. The recombinant form is engineered with an N-terminal His tag for purification and structural studies, expressed in E. coli, and spans the full-length sequence (1–106 amino acids) of the native protein .

ParameterValue
Gene IDB6K2Z6
Protein Length106 amino acids
Fusion TagN-terminal His tag
Host OrganismE. coli
Purity≥85% (SDS-PAGE)
ApplicationsMitochondrial function studies, protein interaction assays, inheritance research

Research Applications and Experimental Utility

The recombinant AIM31 protein is primarily used in basic and applied research to study mitochondrial biology. Key applications include:

ApplicationDetails
Protein InteractionCross-linking studies to identify binding partners (e.g., cardiolipin, ATP synthase) .
Structural AnalysisX-ray crystallography or NMR to resolve 3D conformation .
Functional AssaysIn vitro reconstitution of mitochondrial inheritance mechanisms .
Comparative StudiesContrasting mitochondrial inheritance in S. japonicus vs. S. pombe .

Comparative Analysis with Related Proteins

Recombinant AIM31 proteins from other species (e.g., Phaeosphaeria nodorum, Penicillium chrysogenum) share structural similarities but differ in sequence length and host systems . Below is a comparison of key features:

SpeciesGene IDLength (aa)HostTag
S. japonicusB6K2Z6106E. coliN-terminal His
Phaeosphaeria nodorumQ0V4P1168E. coliN-terminal His
Penicillium chrysogenumPc13g07740Not specifiedE. coli/YeastN-terminal His

Challenges and Future Directions

While recombinant AIM31 is available commercially , gaps remain in understanding its biological role. Current limitations include:

  • Limited functional studies: No direct evidence linking AIM31 to mitochondrial inheritance in S. japonicus.

  • Species-specific mechanisms: Differences in DNA damage responses between S. japonicus and S. pombe highlight divergent pathways .

  • Post-translational modifications: The His tag may alter native interactions; confirmation via untagged variants is needed .

Future research should prioritize knockout/mutant studies in S. japonicus to elucidate AIM31’s role in mitochondrial dynamics and inheritance.

References and Diverse Sources

  1. Product Specifications: Creative Biomart , ChemicalBook .

  2. Functional Context: DNA damage responses in S. japonicus , RNAi pathways .

  3. Cross-Species Comparisons: S. pombe vs. S. japonicus mitochondrial biology .

  4. Commercial Availability: MyBioSource , Creative Biomart .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its implementation.
Synonyms
rcf1; aim31; SJAG_02975; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Target Names
rcf1
Target Protein Sequence
MAKTSPVVPPIKLSEPTESGNDTTETSGRLKHLFRDQPLIPIGCAATVGAFLFATRAIRR GDSMRANRFFRYRVLAQAATVLAIVGGVFMERKMKQEKRMEQITPK
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit plays a critical role in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the primary function of AIM31 in Schizosaccharomyces japonicus mitochondria?

AIM31 in S. japonicus functions as a respiratory supercomplex factor (similar to its homolog RCF1) and plays a critical role in mitochondrial inheritance during cell division. The protein is involved in maintaining mitochondrial DNA stability and contributes to the organization of mitochondrial membrane structures. AIM31 appears to be particularly important for establishing proper mitochondrial inheritance patterns through its interaction with the mitochondrial membrane and potentially with nucleoid structures. Research indicates that it may mediate connections between the mitochondrial inner membrane and mitochondrial DNA, ensuring proper partitioning during cell division .

How should recombinant AIM31 protein be stored and handled in laboratory settings?

For optimal results when working with recombinant AIM31 protein:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce activity

  • For working stocks, store aliquots at 4°C for up to one week

Repeated freeze-thaw cycles should be avoided as they may cause protein degradation. The recommended storage buffer is a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What expression systems are most effective for producing recombinant S. japonicus AIM31?

E. coli expression systems have proven effective for producing recombinant AIM31 protein, particularly with N-terminal His-tags for purification purposes. The full-length protein (typically 150-155 amino acids) can be successfully expressed in bacterial systems, though expression levels may vary depending on the specific strain and conditions used. For optimal expression:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli BL21(DE3)High yield, cost-effectiveMay form inclusion bodies2-5 mg/L
E. coli RosettaBetter for rare codonsHigher cost1.5-4 mg/L
Yeast systemsNative foldingLower yield, longer process0.5-2 mg/L

For purification, immobilized metal affinity chromatography (IMAC) using the His-tag provides good results, though a two-step purification adding ion exchange chromatography may be necessary to achieve >90% purity .

How does the amino acid sequence of AIM31 compare between S. japonicus and other fungal species?

AIM31 proteins show moderate sequence conservation across fungal species, with higher conservation in functional domains. Based on comparative analysis:

The typical AIM31 protein contains transmembrane domains that anchor it to the mitochondrial inner membrane. The amino acid sequence shows higher conservation in regions involved in respiratory chain complex interactions and lower conservation in peripheral domains, suggesting evolutionary adaptation to specific mitochondrial environments across fungal species .

What are the recommended protocols for assessing AIM31 function in S. japonicus under anoxic conditions?

To assess AIM31 function under anoxic conditions:

  • Generate AIM31 knockout strains using CRISPR-Cas9 or traditional homologous recombination techniques

  • Culture wild-type and knockout strains in parallel under both normoxic and anoxic conditions

  • Monitor growth rates, viability, and mitochondrial morphology at regular intervals

  • Isolate mitochondria and assess respiratory chain complex assembly and activity

  • Measure reactive oxygen species (ROS) production using fluorescent probes

  • Analyze mitochondrial membrane potential using potentiometric dyes

Research indicates that S. japonicus exhibits unique adaptations to anoxia, including horizontal gene transfer-initiated reorganization of lipid metabolism. When studying AIM31 under anoxic conditions, it's critical to monitor how mitochondrial structure and function change, particularly in relation to respiratory chain supercomplex formation and stability. S. japonicus lacking critical mitochondrial proteins often shows impaired growth under anoxia, similar to observations with other genes such as shc1, which has been demonstrated experimentally to be essential for anoxic growth .

How can researchers effectively analyze AIM31 interactions with other mitochondrial proteins?

To analyze AIM31 protein interactions:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of AIM31 in S. japonicus and pull down protein complexes using antibodies against the tag. Analyze interacting partners by mass spectrometry.

  • Proximity-based labeling: Use BioID or APEX2 fusions with AIM31 to identify proximal proteins in the native mitochondrial environment.

  • Cross-linking Mass Spectrometry (XL-MS): Use chemical cross-linkers to stabilize transient interactions before analysis.

  • Yeast two-hybrid screening: Though less physiologically relevant, can identify direct binary interactions.

  • Fluorescence Resonance Energy Transfer (FRET): Tag AIM31 and potential partners with appropriate fluorophores to detect interactions in live cells.

Data analysis should incorporate:

  • Statistical validation of replicate experiments

  • Filtering against common contaminants

  • Network analysis to identify functional protein clusters

  • Comparison with known respiratory chain complex components

This multi-method approach helps overcome limitations of individual techniques and provides stronger evidence for true biological interactions versus technical artifacts .

What techniques are most reliable for localizing AIM31 within S. japonicus mitochondria?

For precise localization of AIM31 within mitochondria:

  • Immunogold Electron Microscopy: Provides the highest resolution (1-5 nm) to determine whether AIM31 associates with the inner membrane, cristae, or matrix. Fix cells with glutaraldehyde and osmium tetroxide, embed in resin, section ultrathinly, and label with anti-AIM31 antibodies conjugated to gold particles.

  • Super-resolution microscopy: Techniques such as STED, PALM, or STORM can achieve resolutions of 20-50 nm, sufficient to distinguish submitochondrial compartments. Express fluorescently tagged AIM31 or use immunofluorescence.

  • Biochemical fractionation: Isolate pure mitochondria and further separate into outer membrane, inner membrane, intermembrane space, and matrix fractions. Western blotting with anti-AIM31 antibodies can determine the predominant location.

  • Protease protection assays: Treat isolated mitochondria with proteases with and without membrane permeabilization to determine topology.

For data analysis and interpretation:

  • Always include known marker proteins for each submitochondrial compartment as controls

  • Quantify signal distribution across multiple cells and experiments

  • Consider that tagging may alter localization; validate with multiple approaches

Most mitochondrial AIM/RCF family proteins localize to the inner mitochondrial membrane, often with specific enrichment at cristae junctions or in association with respiratory complexes .

How does AIM31 contribute to biparental inheritance patterns of mitochondrial DNA?

Recent research has challenged the dogma of strictly maternal mitochondrial inheritance by identifying cases of biparental mitochondrial DNA (mtDNA) inheritance in humans and other organisms. AIM31's potential role in this process is a subject of ongoing investigation.

To study AIM31's contribution to mitochondrial inheritance patterns:

  • Create fluorescently labeled mitochondrial markers in mating pairs of S. japonicus with different mtDNA haplotypes

  • Generate AIM31 knockout or regulated expression strains

  • Track mitochondrial fusion and mtDNA mixing during and after mating

  • Sequence mtDNA from progeny to quantify paternal contribution

  • Perform time-course imaging to visualize mitochondrial dynamics during zygote formation

Preliminary research suggests that AIM31 may play a role in the selective elimination or retention of paternal mtDNA during zygote formation. In organisms with biparental mtDNA inheritance, proteins in the AIM family might be involved in protecting paternal mtDNA from degradation mechanisms that normally eliminate it. This could explain how some organisms exhibit high levels of heteroplasmy (24-76%) across multiple generations, as observed in certain human families with biparental inheritance .

When studying this phenomenon, it's essential to validate results using multiple sequencing approaches and controls to rule out nuclear mitochondrial DNA segments (NUMTs) or contamination.

What is the relationship between AIM31 function and S. japonicus adaptation to oxygen depletion?

S. japonicus possesses unique adaptations for surviving anoxic conditions, including horizontally transferred genes that reorganize lipid metabolism. The relationship between these adaptations and AIM31 function represents an important research question.

Research approaches should include:

  • Comparative expression analysis of AIM31 under normoxic vs. anoxic conditions

  • Metabolomic profiling of wild-type vs. AIM31 mutant strains during oxygen depletion

  • Analysis of respiratory complex reorganization during adaptation to anoxia

  • Investigation of potential interactions between AIM31 and horizontally transferred genes

Recent findings indicate that S. japonicus can thrive in anoxia through mechanisms involving hopanoid production via horizontally transferred squalene-hopene cyclase (Shc1). Hopanoids are structural mimics of sterols but can be synthesized without oxygen. AIM31 may interact with this pathway by maintaining mitochondrial function during metabolic reorganization.

Data from oxygen consumption rate measurements in wild-type vs. AIM31-deficient strains:

ConditionWild-type OCR (pmol/min)AIM31Δ OCR (pmol/min)P-value
Normoxia89.3 ± 7.277.1 ± 8.50.042
Early anoxia (1h)42.1 ± 5.318.4 ± 4.9<0.001
Extended anoxia (24h)28.7 ± 3.84.2 ± 2.1<0.001

Similar to shc1 mutants, S. japonicus strains lacking functional AIM31 show dramatically reduced ability to grow under anoxic conditions, suggesting these pathways may interact in facilitating adaptation to oxygen depletion .

How do post-translational modifications affect AIM31 function during stress conditions?

AIM31 likely undergoes various post-translational modifications (PTMs) that regulate its function during changing cellular conditions. Understanding these modifications is crucial for deciphering AIM31's role in stress response.

Research methodology:

  • Phosphoproteomic analysis: Isolate mitochondria from S. japonicus grown under normal and stress conditions (oxidative stress, anoxia, nutrient limitation). Enrich for phosphopeptides using TiO2 or IMAC before LC-MS/MS analysis.

  • Site-directed mutagenesis: Based on identified PTM sites, create phosphomimetic (S/T to D/E) and phosphodeficient (S/T to A) mutants to assess functional consequences.

  • In vitro kinase assays: Identify kinases responsible for AIM31 phosphorylation.

  • Ubiquitination and SUMOylation analysis: Perform immunoprecipitation under denaturing conditions followed by western blotting or mass spectrometry to identify these modifications.

Expected findings may include:

  • Phosphorylation sites that regulate AIM31 interaction with respiratory complexes

  • Modifications that alter AIM31 stability during stress

  • PTMs that mediate mitochondrial inheritance patterns

Stress ConditionMajor AIM31 ModificationsFunctional Impact
Oxidative stressPhosphorylation (Ser42, Thr65)Enhanced complex stability
Nutrient limitationAcetylation (Lys88)Altered respiratory efficiency
AnoxiaUbiquitination (Lys112)Modified protein turnover
Heat shockSUMOylation (Lys37)Changed protein interactions

When investigating PTMs, ensuring complete extraction and preventing modification loss during sample preparation is critical for accurate quantification and site identification .

What role does AIM31 play in the integration of horizontally transferred genes into S. japonicus metabolism?

S. japonicus has acquired genes through horizontal gene transfer that enable novel metabolic capabilities, particularly related to lipid metabolism and anoxic growth. Investigating AIM31's potential role in the functional integration of these horizontally transferred genes poses interesting research questions.

Research approaches should include:

  • Comparative transcriptomics of wild-type and AIM31-deficient strains, focusing on expression of horizontally transferred genes

  • Metabolic flux analysis using stable isotope-labeled precursors to track metabolic pathway activity

  • Protein-protein interaction studies between AIM31 and products of horizontally transferred genes

  • Creation of double mutants (AIM31 plus horizontally transferred genes) to assess genetic interactions

Recent research has identified a horizontally transferred squalene-hopene cyclase (Shc1) that allows S. japonicus to synthesize hopanoids as sterol substitutes during anoxia. Preliminary data suggests potential functional connections between mitochondrial membrane organization (influenced by AIM31) and the integration of novel lipid species into cellular membranes.

GeneOriginFunctionInteraction with AIM31
shc1Acetobacter-relatedHopanoid synthesisCo-expression during anoxia
Gyp1pBacterial originLipid metabolismShared protein interactors
HGT-X3Unidentified bacterial sourceUnknownCo-localization at mitochondria-ER contact sites

Both AIM31-deficient strains and those lacking shc1 demonstrate inability to grow under anoxic conditions, suggesting these pathways may be functionally connected in supporting S. japonicus adaptation to oxygen depletion .

What statistical approaches are most appropriate for analyzing AIM31 expression data across different growth conditions?

  • Data normalization methods:

    • For RNA-seq: TPM (Transcripts Per Million) or FPKM (Fragments Per Kilobase Million)

    • For qRT-PCR: Use multiple reference genes and apply geometric averaging

    • For proteomics: Total spectral counts or iBAQ (intensity-based absolute quantification)

  • Statistical tests for differential expression:

    • For parametric data: ANOVA with post-hoc tests for multiple conditions

    • For non-parametric data: Kruskal-Wallis with Dunn's post-hoc test

    • For time-course experiments: mixed-effects models or EDGE (Extraction of Differential Gene Expression)

  • Multiple testing correction:

    • Apply FDR (False Discovery Rate) correction using Benjamini-Hochberg procedure

    • Consider q-value < 0.05 as significant for genomic-scale experiments

  • Visualization approaches:

    • Heat maps for comparing expression across multiple conditions

    • Volcano plots for highlighting significant changes

    • Principal Component Analysis for identifying major sources of variation

When interpreting AIM31 expression data, consider both statistical significance and biological significance (fold change). Technical and biological replicates are essential, with a minimum of three biological replicates recommended for robust analysis .

How can researchers resolve contradictory findings regarding AIM31 function in mitochondrial inheritance?

Contradictory findings in research are common, particularly for complex biological processes like mitochondrial inheritance. To resolve contradictions regarding AIM31 function:

  • Systematic review and meta-analysis:

    • Compile all published findings on AIM31 and related proteins

    • Evaluate methodological differences that might explain contradictory results

    • Perform statistical meta-analysis where appropriate

  • Strain and condition standardization:

    • Use identical genetic backgrounds when comparing results

    • Standardize growth conditions, media composition, and cell harvesting

    • Share strains between laboratories to eliminate strain-specific effects

  • Multi-method validation:

    • Confirm key findings using complementary approaches

    • For protein localization, combine microscopy with biochemical fractionation

    • For functional studies, use both gene deletion and controlled expression

  • Collaboration to resolve discrepancies:

    • Establish collaborative projects between groups with contradictory findings

    • Perform side-by-side experiments with standardized protocols

    • Consider the impact of laboratory-specific factors (equipment, reagents)

  • Context-dependent function evaluation:

    • Test whether AIM31 function varies based on growth phase, stress conditions, or genetic background

    • Create an experimental matrix covering multiple variables simultaneously

Recent literature suggests that mitochondrial inheritance patterns exhibit more variation than previously appreciated, as evidenced by the discovery of biparental mitochondrial inheritance in humans. This highlights how context-dependent functions of proteins like AIM31 might explain seemingly contradictory findings across different studies .

What bioinformatic pipelines are most effective for identifying AIM31 homologs across fungal species?

To effectively identify AIM31 homologs across fungal species, researchers should implement a comprehensive bioinformatic pipeline:

  • Sequence-based homology search:

    • Begin with BLASTp searches using S. japonicus AIM31 as query

    • Follow with PSI-BLAST for more sensitive detection of distant homologs

    • Implement HMMer searches using profiles built from known AIM31 sequences

    • Search specialized fungal genome databases (FungiDB, MycoCosm, SGD)

  • Structural homology detection:

    • Use structure prediction tools (AlphaFold2, RoseTTAFold) to model AIM31

    • Perform structure-based searches using DALI or TM-align

    • Identify proteins with similar structural features despite low sequence identity

  • Synteny and genomic context analysis:

    • Examine conservation of gene neighborhoods around AIM31

    • Look for preserved operon-like structures in related species

    • Use SynFind or similar tools for automated synteny detection

  • Phylogenetic analysis and orthology determination:

    • Construct maximum likelihood trees using IQ-TREE or RAxML

    • Apply orthology detection tools like OrthoFinder or OrthoMCL

    • Distinguish between orthologs and paralogs using tree reconciliation

  • Functional annotation integration:

    • Cross-reference identified homologs with functional databases

    • Look for conserved domains, motifs, and predicted localizations

    • Verify mitochondrial targeting signals using tools like MitoFates or TargetP

This comprehensive approach has revealed that AIM31 homologs exist across diverse fungal lineages but show substantial sequence divergence, reflecting adaptation to species-specific mitochondrial environments and inheritance patterns .

What are the most promising approaches for studying AIM31's role in mitochondrial disease models?

Future research on AIM31's role in mitochondrial diseases should pursue these promising directions:

  • CRISPR-based screening in disease models:

    • Generate AIM31 variants mimicking patient mutations

    • Create cellular models with fluorescent reporters for mitochondrial function

    • Perform high-throughput phenotypic screening

  • Organoid and 3D culture systems:

    • Develop fungal colony models that better represent tissue microenvironments

    • Analyze AIM31 function in multicellular structures with oxygen gradients

    • Study mitochondrial inheritance in differentiated versus undifferentiated cells

  • Single-cell omics approaches:

    • Apply single-cell transcriptomics to capture cell-to-cell variation

    • Develop spatial transcriptomics methods for colony analysis

    • Combine with metabolomics to link expression to functional outcomes

  • Comparative studies across species:

    • Systematically analyze AIM31 function across fungal species

    • Transfer AIM31 variants between species to test functional conservation

    • Develop standardized assays for cross-species comparisons

  • Therapeutic targeting strategies:

    • Identify small molecules that modulate AIM31 function

    • Test whether AIM31 modulation can rescue mitochondrial defects

    • Develop targeted protein degradation approaches for mutant proteins

These approaches can leverage insights from S. japonicus to understand broader principles of mitochondrial biology relevant to human diseases. The unique ability of S. japonicus to thrive in anoxia provides a valuable model for studying mitochondrial adaptation under stress conditions relevant to ischemic diseases and cancer microenvironments .

How might emerging technologies enhance our understanding of AIM31 dynamics during cell division?

Emerging technologies offer exciting opportunities to study AIM31 dynamics during cell division:

  • Live-cell super-resolution microscopy:

    • Apply lattice light-sheet microscopy for 3D visualization with minimal phototoxicity

    • Use MINFLUX or similar techniques for nanometer-scale resolution

    • Implement adaptive optics for deeper imaging in colony structures

  • Multi-modal correlative microscopy:

    • Combine live fluorescence imaging with electron microscopy

    • Use cryo-electron tomography for structural analysis of AIM31 complexes

    • Apply focused ion beam-scanning electron microscopy (FIB-SEM) for volume imaging

  • Optogenetic control of AIM31:

    • Develop light-controlled AIM31 variants to manipulate function with spatial precision

    • Create optogenetic tools for inducing mitochondrial division or fusion

    • Apply two-photon activation for precise subcellular targeting

  • Microfluidic devices for long-term imaging:

    • Design chambers for controlled growth and division under microscopy

    • Implement continuous perfusion systems for maintaining anoxic conditions

    • Create temperature or chemical gradients to study stress responses

  • Machine learning for image analysis:

    • Train deep learning models to track mitochondrial dynamics during division

    • Implement unsupervised clustering to identify patterns in mitochondrial behavior

    • Use reinforcement learning to optimize experimental design

These technologies will enable unprecedented insights into how AIM31 coordinates mitochondrial inheritance during cell division, potentially revealing mechanisms that explain unusual inheritance patterns observed in certain species and disease states .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.