Recombinant Schizosaccharomyces japonicus Probable endonuclease lcl3 (lcl3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lcl3; SJAG_01749; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Target Names
lcl3
Target Protein Sequence
MQNQRNEYSISLRNLSYIILTISTGIVIHRKFRRIKDIEDLSSRFFRGQQKSLTKLNSLY GYVTSVGDGDNFRFYHTPGGRLLGWHWLRKVPSNRNALKNETLSIRLSGIDAPESGYFGK LGQPFSLEAKQFLARKLEHRSVRVYPLHRDQYNRAVCGVTYYPIRWLFFKRDIGPQLVSR GLAVVYEGANSSYYPTEKSVLMKIQETARKRKLGMHSLGNKLELPKDYKKRNK
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is S. japonicus and why is it becoming important as a model organism?

S. japonicus is a fission yeast species evolutionarily distinct from commonly used model yeasts like S. pombe and S. cerevisiae. It has several unique characteristics that make it valuable for research: it produces 8-spored asci (versus 4-spored in other yeasts), undergoes mitosis with partial nuclear membrane breakdown, and exhibits remarkably fast growth with a generation time of only 63 minutes . Additionally, meiotic analysis can be completed in just 2.5 days, compared to over 7 working days in traditional yeast models . These properties make S. japonicus particularly useful for studying fundamental eukaryotic processes, including those involving nuclear enzymes like endonucleases.

The species has two known varieties - japonicus and versatilis - which offer complementary experimental advantages despite being genetically compatible . Importantly, S. japonicus has demonstrated unique metabolic capabilities, including adaptation to anoxic environments through horizontal gene transfer mechanisms, suggesting it may be valuable for studying genetic innovation and metabolic reprogramming .

What experimental systems are available for genetic manipulation of S. japonicus?

Several robust genetic manipulation systems have been established for S. japonicus research. Gene deletion can be accomplished using antibiotic resistance markers such as the Nourseothricin (Nat) cassette, which replaces target genes in the genome and confers resistance to nourseothricin antibiotic . This marker allows for efficient selection of transformed cells and can be scored in just 12 hours of growth on selective medium .

For mating-type studies, heterothallic mutants have been developed through deletion of donor mating-type loci (mat2/3Δ), which prevent mating-type switching . In the versatilis variety, such mutants can be efficiently isolated using iodine vapor staining of sporulated colonies, while in the japonicus variety (which lacks the iodine-staining phenotype), isolation requires microscopic analysis of individual colonies . Crosses between different strains can be established for genetic analysis, with zygote formation occurring within 5 hours and matured 8-spored asci appearing within the next 4 hours at 30°C .

Key methodological considerations include:

  • Micromanipulation can be used for ascus dissection within 3 hours post-maturation

  • Segregant colonies suitable for genotyping develop within 36 hours after dissection

  • Complete meiotic analysis can be performed in approximately 60 hours from cross initiation

What are the optimal growth and culture conditions for S. japonicus?

Optimal growth conditions for S. japonicus involve standard yeast media with specific considerations for experimental goals. The organism can be cultured in both rich YES (Yeast Extract with Supplements) medium and modified YNB (Yeast Nitrogen Base) medium . Temperature management is critical, with 30°C being the standard temperature for inducing mating, meiosis, and sporulation processes .

For genetic and phenotypic studies, several specialized media formulations may be employed:

  • Nutritional dropout media for selective growth of auxotrophic markers

  • Antibiotic-containing media (e.g., nourseothricin) for selection of transformed strains

  • Media with specific lipid compositions for studies involving membrane properties

When working with recombinant proteins like endonucleases, expression conditions must be optimized based on promoter systems and protein characteristics. Given S. japonicus' unique metabolic capabilities, the organism can be cultured in both aerobic and anaerobic conditions, with the latter being particularly valuable for studies of oxygen-dependent processes . This versatility makes S. japonicus suitable for investigating protein function under varying oxygen tensions.

How does the cell cycle and division process in S. japonicus impact experimental design?

The cell cycle and division characteristics of S. japonicus have important implications for experimental design, particularly when studying nuclear proteins like endonucleases. Unlike other yeasts, S. japonicus undergoes mitosis with partial breakdown of the nuclear membrane , which may affect nuclear protein localization and activity during cell division. This unique feature provides opportunities to study nuclear dynamics during mitosis that aren't available in other yeast models.

Cell morphology metrics in S. japonicus wild-type cells include:

  • Cell length at division ranges from approximately 44-54 μm (in YES medium)

  • Cell width at division ranges from approximately 30-45 μm (in YES medium)

These parameters may vary depending on growth conditions and genetic background, with mutants often showing altered cellular dimensions . Researchers should consider these morphological characteristics when designing microscopy-based assays for studying protein localization or activity.

The remarkably short generation time of 63 minutes allows for rapid experimental cycles , but also necessitates careful timing of sampling and intervention during time-course experiments. When designing experiments to track protein activity through the cell cycle, researchers must account for this compressed timeframe compared to other model organisms.

How does horizontal gene transfer influence metabolic reprogramming in S. japonicus and what implications might this have for nuclear enzyme function?

Horizontal gene transfer (HGT) has played a significant role in reshaping S. japonicus metabolism, particularly in enabling adaptation to anoxic environments. Research has demonstrated that S. japonicus acquired a horizontally transferred squalene-hopene cyclase gene (Shc1) from an Acetobacter-related bacterial species . This enzyme allows for oxygen-independent synthesis of hopanoids, which are structural mimics of eukaryotic sterols, enabling S. japonicus to thrive in anoxic conditions where conventional sterol biosynthesis is impossible .

The integration of this horizontally transferred gene into S. japonicus metabolism has prompted comprehensive reorganization of its lipid metabolism. This adaptation includes modifications to:

  • Glycerophospholipid fatty acyl asymmetry

  • Changes in phospholipid head group composition

  • Altered fatty acid desaturation levels

  • Adjustments in fatty acid chain length

These membrane adaptations enable accommodation of both native (sterols) and foreign (hopanoids) triterpenoids in cellular membranes . For nuclear enzymes like endonucleases, these membrane composition changes may influence nuclear envelope properties, potentially affecting protein import/export dynamics, enzyme-substrate interactions, and chromatin accessibility.

Research methodologies to investigate these effects might include:

  • Lipidomic profiling of nuclear membranes under varying oxygen conditions

  • Localization studies of nuclear enzymes in wild-type versus Shc1Δ mutants

  • In vitro enzyme activity assays with reconstituted membrane systems

  • Chromatin accessibility assays under aerobic versus anaerobic conditions

What methodological approaches can be used to characterize the biochemical properties of recombinant lcl3 endonuclease?

Characterizing the biochemical properties of a recombinant endonuclease from S. japonicus would require a systematic approach combining multiple experimental techniques. Leveraging S. japonicus' unique attributes can enhance traditional biochemical characterization methods.

For expression and purification, researchers should consider:

  • Expressing the recombinant protein in either S. japonicus itself or heterologous systems

  • Comparing activity of protein expressed under aerobic versus anaerobic conditions

  • Using affinity tags (e.g., His-tag, FLAG-tag) for purification while considering their potential impact on enzyme activity

  • Employing size exclusion chromatography to determine oligomeric state

For functional characterization, essential assays include:

  • Nuclease activity assays using various DNA substrates (circular, linear, single-stranded, double-stranded)

  • Determination of metal ion requirements (Mg²⁺, Mn²⁺, Ca²⁺) for catalytic activity

  • Assessment of sequence specificity using systematic substrate libraries

  • Kinetic parameter determination (Km, Vmax, kcat) under varying conditions

Environmental condition testing should examine:

  • pH optima and stability profiles

  • Temperature dependence and thermal stability

  • Activity changes in response to oxygen tension

  • Effects of membrane components (sterols, hopanoids) on enzyme activity in reconstituted systems

How can genetic approaches be optimized to study the biological role of lcl3 in S. japonicus?

Genetic investigation of lcl3 function in S. japonicus would benefit from the organism's rapid generation time and efficient meiotic analysis capabilities. Several complementary approaches can be employed to elucidate its biological role.

For gene disruption and modification:

  • Gene deletion using antibiotic resistance markers (e.g., Nourseothricin resistance cassette)

  • Conditional expression systems to regulate lcl3 levels temporally

  • Introduction of point mutations to disrupt catalytic activity while maintaining protein structure

  • Fluorescent protein tagging for localization studies, exploiting S. japonicus' unique nuclear division characteristics

Phenotypic analysis of mutants should assess:

  • Growth rates under various stress conditions (DNA damaging agents, replication inhibitors)

  • Cell cycle progression and checkpoint activation

  • DNA damage accumulation using fluorescent markers or electron microscopy

  • Genetic interactions through systematic double mutant analysis

Meiotic studies can leverage S. japonicus' 8-spored asci to investigate:

  • Recombination frequency and distribution

  • Spore viability and germination efficiency

  • Chromosome segregation fidelity

  • Genetic linkage analysis

The genetic compatibility between japonicus and versatilis varieties offers additional opportunities for examining lcl3 function in different genetic backgrounds . When dissecting linear asci (which occur in approximately 20% of S. japonicus zygotes), researchers can directly track the segregation of lcl3 variants through meiosis and the subsequent mitotic division .

What technical considerations are important when designing experiments to study lcl3 localization and dynamics in living cells?

Investigating the localization and dynamics of lcl3 in living S. japonicus cells presents both challenges and opportunities due to the organism's unique cellular characteristics. Several technical considerations are critical for successful experimental design.

For fluorescent protein tagging:

  • Selection of appropriate fluorescent proteins considering S. japonicus' growth conditions

  • Careful placement of tags to minimize disruption of localization signals and catalytic activity

  • Use of linker sequences to reduce steric hindrance

  • Validation of fusion protein functionality through complementation assays

Microscopy considerations include:

  • Accounting for S. japonicus' cell dimensions (length at division: 44-54 μm; width: 30-45 μm)

  • Optimizing imaging parameters for the organism's partial nuclear envelope breakdown during mitosis

  • Implementing temperature control systems to maintain optimal growth during imaging

  • Using appropriate mounting media that supports S. japonicus viability

For capturing dynamic processes:

  • High-speed imaging to track protein movement during the rapid 63-minute cell cycle

  • Photoactivatable or photoconvertible tags for pulse-chase experiments

  • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

  • Single-particle tracking for detailed mobility analysis

Environmental considerations include:

  • Imaging under both aerobic and anaerobic conditions to assess oxygen-dependent changes

  • Controlling membrane composition through genetic manipulation (erg1Δ or shc1Δ mutants)

  • Assessing localization changes in response to DNA damage or replication stress

  • Comparing dynamics in different cell cycle phases

How does S. japonicus compare to other yeast models for studying nuclear enzymes?

S. japonicus offers several distinctive advantages for studying nuclear enzymes compared to traditional yeast models. These differences impact experimental design and interpretation when investigating proteins like endonucleases.

Table 1: Comparative Analysis of Yeast Models for Nuclear Enzyme Research

CharacteristicS. japonicusS. pombeS. cerevisiaeImplications for Nuclear Enzyme Research
Generation time63 minutes2-3 hours1.5-2 hoursFaster experimental cycles; requires precise timing for cell cycle studies
Nuclear divisionPartial nuclear envelope breakdownClosed mitosisClosed mitosisUnique opportunity to study nuclear protein dynamics during envelope breakdown
Sporulation8-spored asci4-spored asci4-spored asciEnhanced genetic analysis; observation of post-meiotic mitosis effects
Meiotic analysis time2.5 days>7 days>7 daysRapid assessment of genetic interactions and inheritance patterns
Genome size11.7 Mb12.57 Mb12.1 MbComparable complexity for genomic studies
Horizontal gene transferDocumented acquisition of metabolic genesLimited evidenceLimited evidenceModel for studying integration of foreign genetic elements
Membrane compositionAdaptable; can utilize hopanoids or sterolsSterol-dependentSterol-dependentFramework for investigating nuclear membrane-protein interactions under varied conditions

S. japonicus exhibits several unique biological properties that make it particularly valuable for nuclear enzyme research. The partial nuclear envelope breakdown during mitosis provides opportunities to study how nuclear proteins redistribute during cell division - a process that cannot be easily examined in other yeasts with closed mitosis. This feature may be especially relevant for nucleases involved in DNA repair and chromosome maintenance.

Additionally, the organism's adaptation to anaerobic growth through horizontally transferred genes offers a platform for investigating how nuclear processes function under varying oxygen tensions. This could reveal novel insights into oxygen-dependent regulation of nuclear enzymes like endonucleases.

What are the key methodological differences when working with membrane-associated proteins in S. japonicus compared to other model systems?

S. japonicus possesses unique membrane characteristics that significantly impact experimental approaches for studying membrane-associated proteins. These differences stem from the organism's distinctive lipid metabolism and adaptation to varying environmental conditions.

The most striking feature of S. japonicus membranes is their ability to incorporate both conventional sterols (ergosterol) and bacterial-like hopanoids . This flexibility is facilitated by:

  • Glycerophospholipid fatty acyl asymmetry

  • Lower levels of fatty acid desaturation compared to other yeasts

  • Adjustable phospholipid headgroup composition

  • Ability to modulate fatty acid chain length

These adaptations enable S. japonicus to thrive in both aerobic and anaerobic environments, with corresponding membrane composition changes . For membrane-associated proteins, including nuclear envelope proteins that might interact with endonucleases, these properties create both experimental challenges and opportunities.

Methodological considerations for membrane protein studies include:

  • Extraction and Solubilization Protocols:

    • Standard detergent formulations may require optimization due to altered lipid composition

    • Different extraction efficiencies may be observed between aerobic and anaerobic cultures

    • Ergosterol-depleted (erg1Δ) or hopanoid-depleted (shc1Δ) mutants may require distinct solubilization conditions

  • Reconstitution Systems:

    • Liposome formulations should consider the unique fatty acid asymmetry of S. japonicus membranes

    • Incorporation of both sterols and hopanoids may be necessary for native-like behavior

    • Model membrane studies can explore how lipid composition affects protein function

  • Localization Studies:

    • Membrane fluidity differences may affect protein mobility and clustering

    • Nuclear envelope dynamics during mitosis require specialized imaging approaches

    • Comparative localization in wild-type, erg1Δ, and shc1Δ backgrounds can reveal lipid dependencies

  • Activity Assays:

    • Buffer compositions should reflect the ionic environment of S. japonicus cells

    • Membrane-associated activities may vary with lipid composition changes

    • Reconstituted systems should account for membrane curvature and lateral organization

What experimental approaches can be used to study the potential role of lcl3 in DNA repair and recombination?

Investigating the role of a putative endonuclease like lcl3 in DNA repair and recombination processes requires multi-faceted experimental approaches that leverage S. japonicus' unique characteristics while incorporating established methods from DNA repair field.

Genetic and Phenotypic Analysis:

  • DNA Damage Sensitivity Assays:

    • Expose lcl3Δ mutants to various DNA damaging agents (UV, MMS, HU, IR)

    • Quantify survival rates and growth inhibition

    • Compare sensitivity profiles to known DNA repair pathway mutants

    • Test epistatic relationships through double mutant analysis

  • Recombination Frequency Measurement:

    • Develop genetic recombination assays using selectable markers

    • Quantify both mitotic and meiotic recombination rates

    • Assess recombination product types (crossovers vs. non-crossovers)

    • Leverage S. japonicus' 8-spored asci for detailed meiotic recombination analysis

Molecular and Biochemical Approaches:

  • DNA Binding and Cleavage Assays:

    • Purify recombinant lcl3 and test substrate preferences

    • Determine structure-specific vs. sequence-specific activity

    • Map cleavage sites using sequencing approaches

    • Assess activity regulation through post-translational modifications

  • Protein-Protein Interaction Studies:

    • Identify interaction partners through co-immunoprecipitation

    • Verify direct interactions using yeast two-hybrid or in vitro binding assays

    • Map interaction domains through truncation analysis

    • Assess impact of DNA damage on interaction networks

Cellular Localization and Dynamics:

  • Damage Response Dynamics:

    • Track lcl3 localization before and after DNA damage induction

    • Quantify recruitment kinetics to damage sites

    • Assess co-localization with known repair proteins

    • Examine behavior during S. japonicus' unique mitosis with partial nuclear envelope breakdown

  • Chromatin Association:

    • Perform ChIP-seq to map genomic binding sites

    • Assess changes in chromatin association during cell cycle

    • Determine relationships to replication structures

    • Investigate binding at specific genome features (telomeres, centromeres, rDNA)

The rapid life cycle of S. japonicus (63-minute generation time) enables efficient screening of multiple conditions and genetic backgrounds, accelerating the discovery process compared to other yeast models.

What emerging technologies could enhance our understanding of lcl3 function in S. japonicus?

The study of endonucleases like lcl3 in S. japonicus could benefit substantially from several emerging technologies that address current methodological limitations and open new research avenues. These technologies could be particularly valuable when leveraging S. japonicus' unique biological properties.

Advanced Genome Editing Approaches:

  • CRISPR-Cas9 systems optimized for S. japonicus could enable:

    • Precise genomic modifications without selection markers

    • High-throughput functional genomics screens

    • Introduction of specific mutations to test structure-function relationships

    • Creation of conditional alleles for essential genes

Single-Molecule Technologies:

  • Single-molecule tracking in living cells could:

    • Reveal the dynamics of individual lcl3 molecules during DNA repair

    • Measure residence times at damage sites

    • Determine diffusion constants in different cellular compartments

    • Assess how membrane composition affects protein mobility

Structural Biology Approaches:

  • Cryo-electron microscopy for:

    • Determining lcl3 structure in complex with DNA substrates

    • Visualizing conformational changes during catalysis

    • Examining integration into multi-protein repair complexes

    • Studying interactions with membrane components

Systems Biology Integration:

  • Multi-omics approaches combining:

    • Transcriptomics to identify genes co-regulated with lcl3

    • Proteomics to map interaction networks and post-translational modifications

    • Metabolomics to assess impacts on cellular metabolism

    • Lipidomics to correlate membrane changes with enzyme function

Microfluidics and Single-Cell Analysis:

  • Microfluidic systems could enable:

    • Precise control of environmental conditions (oxygen levels, nutrients)

    • Real-time observation of cellular responses to DNA damage

    • Tracking of repair processes through multiple cell divisions

    • Correlation between repair efficiency and cell fate decisions

These emerging technologies would be particularly powerful when combined with S. japonicus' rapid generation time (63 minutes) and efficient genetic analysis capabilities, potentially accelerating discovery compared to work in traditional model organisms.

How might membrane composition changes in S. japonicus under different growth conditions affect nuclear processes?

The remarkable membrane adaptability of S. japonicus in response to environmental conditions represents a unique platform for investigating how membrane properties influence nuclear processes, including those involving enzymes like endonucleases. This organism's ability to modulate membrane composition through both conventional sterols and bacterial-like hopanoids offers unprecedented research opportunities .

Membrane Adaptation Mechanisms in S. japonicus:

Research has shown that S. japonicus employs several mechanisms to adapt its membranes to environmental changes:

  • In aerobic conditions:

    • Both ergosterol and hopanoid biosynthesis pathways operate

    • Glycerophospholipids exhibit fatty acyl asymmetry

    • Moderate levels of fatty acid desaturation occur

    • Balanced phospholipid headgroup ratios are maintained

  • In anaerobic conditions:

    • Ergosterol biosynthesis is inhibited (oxygen-dependent)

    • Hopanoid synthesis increases (oxygen-independent)

    • Fatty acid desaturation is virtually absent

    • Higher amounts of asymmetrical glycerophospholipid species are produced

    • Phosphatidylethanolamine to phosphatidylcholine/phosphatidylinositol ratio decreases

These adaptations enable S. japonicus to maintain membrane integrity and function across diverse environments, but they likely also impact nuclear envelope properties and consequently nuclear processes.

Potential Impacts on Nuclear Functions:

  • Nuclear Transport:

    • Altered lipid composition may affect nuclear pore complex integration

    • Changes in membrane fluidity could influence transport kinetics

    • Differential protein-lipid interactions might modify importin/exportin function

  • Chromatin Organization:

    • Nuclear envelope-chromatin interactions depend on membrane properties

    • Lamin-associated domains may respond to lipid environment changes

    • Altered nuclear mechanics could impact chromosome positioning

  • DNA Repair Dynamics:

    • Nuclear envelope breakdown during mitosis exposes chromosomes differently

    • Repair protein access to damage sites may vary with nuclear membrane properties

    • Lipid composition might influence phase separation of repair complexes

  • Cell Cycle Regulation:

    • Nuclear envelope remodeling during S. japonicus' unique mitosis may be affected

    • Checkpoint signaling across the nuclear envelope could depend on membrane properties

    • Coordination between cytoplasmic and nuclear events may be modulated

Experimental Approaches:

To investigate these relationships, researchers could:

  • Compare nuclear protein dynamics in wild-type, erg1Δ, and shc1Δ strains

  • Assess DNA repair efficiency under aerobic versus anaerobic conditions

  • Examine nuclear envelope resilience to mechanical stress with varying lipid compositions

  • Analyze chromosomal territory organization with differential membrane lipid content

This research direction could reveal fundamental principles about how membrane properties influence nuclear processes across eukaryotes, with S. japonicus serving as an exceptional model system due to its natural capacity for membrane composition modulation.

What are the main technical challenges in purifying active recombinant endonucleases from S. japonicus and how can they be addressed?

Purifying active recombinant endonucleases from S. japonicus presents several technical challenges stemming from the organism's unique biology and the general difficulties associated with nuclease purification. These challenges require specialized approaches for successful protein production and characterization.

Challenge 1: Expression System Selection

S. japonicus has different membrane composition and cellular physiology compared to common expression hosts . This may affect proper folding and activity of recombinant endonucleases.

Solutions:

  • Develop homologous expression systems using S. japonicus itself

  • Compare protein activity from S. japonicus versus heterologous hosts

  • Optimize expression conditions (temperature, media composition, induction timing)

  • Test expression under both aerobic and anaerobic conditions to assess oxygen effects

Challenge 2: Preventing Nuclease Degradation of Host DNA

Active endonucleases can damage host DNA during expression, leading to toxicity and reduced yields.

Solutions:

  • Use tightly regulated inducible promoters to control expression timing

  • Express inactive mutants (catalytic site mutations) followed by in vitro reactivation

  • Co-express specific inhibitors that can be removed during purification

  • Develop compartmentalization strategies to separate enzyme from host DNA

Challenge 3: Maintaining Nuclease Stability During Purification

Nucleases are often sensitive to oxidation, proteolysis, and aggregation during purification processes.

Solutions:

  • Include reducing agents (DTT, β-mercaptoethanol) in purification buffers

  • Add metal chelators (EDTA) to reversibly inhibit activity during early purification steps

  • Use protease inhibitor cocktails optimized for S. japonicus proteases

  • Perform purification at reduced temperatures to minimize proteolysis

  • Include appropriate stabilizing agents (glycerol, sucrose) in storage buffers

Challenge 4: Assessing Native Substrates and Specificity

Determining the authentic substrates and specificity of a novel endonuclease requires systematic approaches.

Solutions:

  • Employ next-generation sequencing to map cleavage sites genome-wide

  • Develop high-throughput substrate screening using oligonucleotide libraries

  • Test activity on various DNA structures (linear, circular, single-stranded, double-stranded)

  • Perform comparative analysis with related endonucleases from other organisms

Challenge 5: Accounting for Lipid-Protein Interactions

S. japonicus' unique membrane characteristics may influence membrane-associated endonuclease activity.

Solutions:

  • Include appropriate lipid mixtures during purification and assay procedures

  • Compare activity in the presence of sterols versus hopanoids

  • Use membrane mimetics for in vitro reconstitution experiments

  • Assess localization and activity in different subcellular fractions

By addressing these challenges with the suggested solutions, researchers can effectively purify and characterize active recombinant endonucleases from S. japonicus, leveraging the organism's unique biology while overcoming its technical limitations.

How can researchers optimize genetic manipulation techniques for studying endonucleases in S. japonicus?

Genetic manipulation of S. japonicus for studying endonucleases requires optimization of existing protocols to account for the organism's unique characteristics. The following methodological approaches can enhance success rates and experimental outcomes.

Vector Design Considerations:

  • Promoter Selection:

    • Characterize native S. japonicus promoters for different expression levels

    • Develop regulated promoter systems responsive to various inducers

    • Consider the SV40 nuclear localization signal for targeting recombinant proteins to the nucleus

    • Test promoter performance under both aerobic and anaerobic conditions

  • Selection Marker Optimization:

    • Utilize established markers like Nourseothricin resistance (Nat)

    • Develop additional selection systems to enable multiple genetic modifications

    • Optimize marker expression levels to reduce fitness costs

    • Consider auxotrophic markers based on S. japonicus metabolism

Transformation Protocol Refinements:

  • Cell Wall Modification:

    • Optimize enzymatic digestion conditions for S. japonicus cell wall

    • Test various osmotic stabilizers during protoplast generation

    • Evaluate electroporation parameters specific to S. japonicus

    • Compare transformation efficiency between exponential and stationary phase cells

  • Homologous Recombination Enhancement:

    • Define optimal homology arm lengths for targeted integration

    • Test microhomology-mediated end joining approaches

    • Develop methods to temporarily suppress non-homologous end joining

    • Optimize carrier DNA concentrations for improved transformation efficiency

Phenotypic Analysis Strategies:

  • Growth Assessment Methods:

    • Utilize S. japonicus' rapid 63-minute generation time for efficient phenotyping

    • Develop high-throughput growth curve analysis under various conditions

    • Standardize colony size measurements at specific timepoints post-plating

    • Implement automated image analysis for morphological characterization

  • DNA Damage Response Evaluation:

    • Establish S. japonicus-specific DNA damage sensitivity assays

    • Develop reporter systems for DNA damage checkpoint activation

    • Optimize immunofluorescence protocols for DNA damage markers

    • Create fluorescent protein fusions to track repair protein dynamics

Meiotic Analysis Approaches:

  • Endonuclease Function During Meiosis:

    • Exploit S. japonicus' 8-spored asci for detailed segregation analysis

    • Utilize the linear asci (occurring in ~20% of zygotes) for ordered tetrad analysis

    • Develop fluorescent chromosome tags to track segregation patterns

    • Optimize synchronization methods for meiotic progression studies

  • Recombination Assessment:

    • Create genetic intervals with selectable markers for recombination measurement

    • Develop systems to distinguish crossover vs. non-crossover events

    • Implement physical assays for DNA double-strand break formation and repair

    • Map meiotic recombination hotspots genome-wide

By implementing these optimized approaches, researchers can effectively leverage S. japonicus' distinctive advantages for studying endonucleases while overcoming technical challenges associated with this emerging model organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.