Recombinant Schizosaccharomyces japonicus Protein get1 (get1)

Shipped with Ice Packs
In Stock

Description

Function and Role in the GET Pathway

The GET pathway is essential for inserting TA proteins into the ER membrane . TA proteins have a single transmembrane domain (TMD) at their C-terminus, which is responsible for anchoring them to the lipid bilayer . The Get1/2 receptor, a complex consisting of Get1 and Get2, plays a crucial role in this process .

  • Mechanism of Action The Get3 ATPase delivers TA proteins to the Get1/2 receptor at the ER membrane . Get1 and Get2 cooperate to capture and remodel the targeting complex, facilitating TA insertion .

  • Subunit Cooperation Get1 and Get2 exhibit extensive cooperation. The cytosolic domains (CDs) of Get1 and Get2 enhance the affinity of the individual subunits for the Get3- TA complex, enabling efficient capture of the targeting complex .

  • Get3 Remodeling Get1CD and Get2CD induce conformational changes in Get3, promoting the release of the TA protein for insertion into the ER membrane . Two molecular recognition features (MoRFs) in Get2CD induce Get3 opening, and both subunits are required for optimal TA release from Get3 .

Experimental Evidence and Research Findings

  • In vivo Studies Mutation of the MoRFs in Get2 attenuates TA insertion into the ER in vivo, demonstrating the importance of Get2-induced Get3 opening for GET-dependent TA insertion .

  • Biochemical Studies Biochemical reconstitution and cell reporter assays have been used to define mutations in the Get1/2 transmembrane domain that disrupt TA protein insertion .

  • FRET Analysis Förster resonance energy transfer (FRET) experiments have shown that Get2CD induces Get3 opening, providing direct evidence that Get2CD can remodel Get3 and bias its conformation to more open states .

Schizosaccharomyces japonicus and Get1

While much of the research on the GET pathway focuses on Saccharomyces cerevisiae, the principles are conserved in other eukaryotic cells, suggesting similar functions in Schizosaccharomyces japonicus . Studies in S. japonicus would likely reveal similar mechanisms and interactions for Get1 and Get2 as those observed in S. cerevisiae.

Related Research

Streptomyces kanasensis: Streptomyces kanasensis ZX01 produces a glycoprotein with antiviral activity, alongside other antibiotics. Genomic analysis of S. kanasensis ZX01 revealed more than 60 putative clusters, with the global regulator nsdA controlling the biosynthesis of some antibiotics and enhancing the production of glycoprotein GP-1 with antiviral activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; SJAG_01178; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Target Names
get1
Target Protein Sequence
MDFLLFLFCLNLFIHLFDKYVKTFLVNQGFRVYARFSGSPEFKSYNDLRLQLLSTKRDLN NVSAQDEFAKWARLNRKFDQLNVKWEKQSKIVSQKSEGVKKLISLTFWIVTRGYRFIVQF KNSGNPVFAVPEGMLPTWALWFLALPKAKTGYVSVAVWNFASQKVISTLL
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.