Recombinant Schizosaccharomyces japonicus Protein sey1 (sey1)

Shipped with Ice Packs
In Stock

Description

Biological Context of Schizosaccharomyces japonicus

Schizosaccharomyces japonicus belongs to the fission yeast genus Schizosaccharomyces, which comprises six currently recognized species. This particular yeast species has emerged as a valuable model organism distinct from the more commonly studied yeasts such as Saccharomyces cerevisiae and Schizosaccharomyces pombe . S. japonicus exhibits several unique evolutionary characteristics that make it particularly interesting for research, including its ability to produce 8-spored asci (in contrast to the 4-spored asci of other yeasts) and its mitotic division process which involves partial breakdown of the nuclear membrane . These distinctive features reflect its evolutionary divergence from other commonly used research yeasts.

Recent genomic research has revealed that S. japonicus has a genome size considerably larger than previous estimates, with recent telomere-to-telomere assembly indicating a genome size between 16.6 Mb and 18.1 Mb . This represents an increase of at least 30% compared to earlier estimations. Additionally, researchers have discovered previously unknown genomic features, including a second centromere-like region on Chromosome 2 . S. japonicus demonstrates remarkable cellular efficiency with a generation time of only 63 minutes, significantly faster than other yeast species which typically exhibit generation times between 1.5 and 2.0 hours . This rapid replication rate makes it an increasingly attractive model organism for biological research.

Primary Structure and Sequence Analysis

The sey1 protein from Schizosaccharomyces japonicus is a full-length protein consisting of 764 amino acids . The complete amino acid sequence has been determined and is characterized by specific functional domains that contribute to its biological activity. The primary sequence is as follows:

MQQSAQLITENKEFNEDFPRFLKDVGLDNVGFDYHVVAVLGSQSTGKSTLLNKLFGTQFSTMDTVRRQQTTKGIWVSRGKDSSILIMDVEGTDGRERGDDQDFERKSALFSIATSEVIIVNMWENQIGLYQGSNMTLLKTVFEVNLQLFHENIERSRLQFVIRDFLGSTSLDNLSETLMTDLNRTWASISKPEGLENSVITDFFDVDFSALPHKVLCAEAFDEETDKLREQFLDEKNPKYLFKPCYHKRIPADGFPLYTQGIWQLIQNNRDLDLPTQQQLLAQYRCDEFIAEAMVSFDEQCEELLTFLKTHQSIENLLQRLEAIQTSTFSIFDENARRYQSEVYTKKRQELDRMMKTRLAVPIQRYLAAIHKELVAGFPERIATLVKDACFKDVARVTVSEMVSVMHSEAAALQKEGFVCDAEQTVETLRVELLQLVRSMREERLAQISAKLMVQFEQEFADAIDVSFHHLTKDIWDNIMHKFDELREKVLDEMLRSLNEYIDDEMDEDAELLRTKHMFKLKRSTWLVLRRTLENETAEPILQQRLRTHFEDSFRYDSRGIPKMWKKSDILENDFNKSLQDTLQLIDVLAIVRLKDGSVPTVDVPLAEEGEDTASNLEADTFFTFLNRKKKANIHVSVKRAADLVFLDCKRSIISTATRPGYFWALLAVLGWNEFVSVLKNPVLLTLLLIVVSFLFILVQTGLAGPVKAFAERSVRNAVNSMGEKLAEKLDDYRSTSPASETTSGRVISAENSSVDEKVSTTP

Analysis of this sequence reveals several conserved motifs that are characteristic of the sey1 family of proteins. These structural elements are critical for the protein's function in membrane dynamics and cellular architecture. The sey1 protein shows considerable homology with its counterparts in other yeast species, suggesting evolutionary conservation of function across different organisms within this taxonomic group.

Protein Identifier and Classification

The sey1 protein from S. japonicus has been assigned the unique protein identifier B6K0N7 in protein databases . This classification enables researchers to track and reference this specific protein across different research databases and publications. The protein belongs to the dynamin-related GTPase family, which is known for its roles in membrane remodeling and tubulation, processes critical for maintaining cellular compartmentalization and organelle structure.

Expression System

The recombinant sey1 protein from S. japonicus has been successfully expressed in Escherichia coli expression systems . This bacterial expression platform offers several advantages for producing recombinant eukaryotic proteins, including high yield, relatively straightforward purification processes, and cost-effectiveness. In the reported expression system, the full-length protein (amino acids 1-764) was fused to an N-terminal histidine tag, which facilitates purification through affinity chromatography techniques .

Role in Cellular Architecture

Based on homology with similar proteins in related organisms, the sey1 protein in S. japonicus likely plays a crucial role in maintaining cellular membrane architecture. In Saccharomyces cerevisiae, the SEY1 protein cooperates with reticulon proteins (RTN1 and RTN2) and the tubule-shaping DP1 family protein YOP1 to generate and maintain tubular structures within the cell . By extension, the S. japonicus sey1 protein is presumed to perform similar functions, contributing to the dynamic remodeling of membrane structures, particularly in the endoplasmic reticulum (ER).

The protein likely functions as a GTPase, as suggested by the presence of characteristic GTP-binding motifs in its sequence. This enzymatic activity is essential for the energy-dependent processes involved in membrane fusion and tubulation. The specific structural elements within the sey1 protein enable it to bind to membranes and facilitate their reshaping into tubular conformations, processes that are fundamental to maintaining the proper morphology and function of the ER network.

Evolutionary Conservation of Function

The functional significance of sey1 is underscored by its evolutionary conservation across different yeast species, including both budding and fission yeasts. This conservation suggests that the protein's role in membrane dynamics represents a fundamental cellular process that has been maintained throughout fungal evolution. The study of sey1 in S. japonicus provides valuable insights into these conserved mechanisms and offers a comparative framework for understanding how these processes may vary between evolutionarily distant organisms.

Model System Applications

S. japonicus has emerged as a promising model organism for biological research, with several advantages over traditionally used yeast species. Its rapid generation time of only 63 minutes and shortened meiotic analysis period (completed in just 2.5 days compared to more than 7 working days in other yeasts) make it particularly suitable for genetic and cellular studies that require multiple generations or crosses . The sey1 protein, as a component of this model system, offers researchers a tool for investigating membrane dynamics and organelle structure in this fast-growing organism.

Biotechnological Potential

The recombinant sey1 protein has potential applications in various biotechnological contexts. As a membrane-remodeling protein, it could be utilized in the development of artificial membrane systems or in the engineering of cellular compartments for specific biotechnological purposes. Additionally, understanding the mechanisms by which sey1 contributes to membrane architecture could inform the design of novel drug delivery systems or cellular engineering approaches that leverage membrane dynamics.

Comparative Genomics and Evolution

The recent completion of high-quality genome assemblies for S. japonicus opens new avenues for comparative genomic research within the Schizosaccharomyces genus . These resources will facilitate more detailed analyses of the evolution of the sey1 gene and its homologs across different yeast species. Such comparative studies could reveal how variations in the sey1 protein sequence correlate with differences in cellular architecture and membrane dynamics between species, providing insights into the adaptive significance of these variations.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
sey1; SJAG_02595; Protein sey1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-764
Protein Length
full length protein
Species
Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Target Names
sey1
Target Protein Sequence
MQQSAQLITENKEFNEDFPRFLKDVGLDNVGFDYHVVAVLGSQSTGKSTLLNKLFGTQFS TMDTVRRQQTTKGIWVSRGKDSSILIMDVEGTDGRERGDDQDFERKSALFSIATSEVIIV NMWENQIGLYQGSNMTLLKTVFEVNLQLFHENIERSRLQFVIRDFLGSTSLDNLSETLMT DLNRTWASISKPEGLENSVITDFFDVDFSALPHKVLCAEAFDEETDKLREQFLDEKNPKY LFKPCYHKRIPADGFPLYTQGIWQLIQNNRDLDLPTQQQLLAQYRCDEFIAEAMVSFDEQ CEELLTFLKTHQSIENLLQRLEAIQTSTFSIFDENARRYQSEVYTKKRQELDRMMKTRLA VPIQRYLAAIHKELVAGFPERIATLVKDACFKDVARVTVSEMVSVMHSEAAALQKEGFVC DAEQTVETLRVELLQLVRSMREERLAQISAKLMVQFEQEFADAIDVSFHHLTKDIWDNIM HKFDELREKVLDEMLRSLNEYIDDEMDEDAELLRTKHMFKLKRSTWLVLRRTLENETAEP ILQQRLRTHFEDSFRYDSRGIPKMWKKSDILENDFNKSLQDTLQLIDVLAIVRLKDGSVP TVDVPLAEEGEDTASNLEADTFFTFLNRKKKANIHVSVKRAADLVFLDCKRSIISTATRV PGYFWALLAVLGWNEFVSVLKNPVLLTLLLIVVSFLFILVQTGLAGPVKAFAERSVRNAV NSMGEKLAEKLDDYRSTSPASETTSGRVISAENSSVDEKVSTTP
Uniprot No.

Target Background

Function
Sey1, in collaboration with reticulon proteins and DP1 family proteins, contributes to the formation and maintenance of the tubular endoplasmic reticulum network. Its GTPase activity is crucial for this function in ER organization.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, RHD3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What cellular functions has sey1 been associated with in recent research?

Recent research has identified several key cellular functions of sey1:

  • ER Membrane Fusion: As a dynamin-like GTPase, sey1 is implicated in homotypic fusion of endoplasmic reticulum (ER) membranes, playing a crucial role in maintaining ER architecture .

  • Lipid Droplet Dynamics: Sey1 has been found to localize to lipid droplets (LDs) and mediate LD recruitment to Legionella-containing vacuoles (LCVs) during Legionella pneumophila infection .

  • GTP-Dependent Membrane Interactions: Experimental evidence suggests that sey1's interactions with cellular membranes are GTP-dependent, with GTP hydrolysis powering conformational changes that enable membrane fusion events .

  • Pathogen-Host Interactions: Studies in Dictyostelium discoideum have shown that sey1 contributes to LCV expansion and intracellular replication of L. pneumophila, indicating its role in pathogen-host interactions .

  • Potential Drug Target: Recent research has identified sey1 as a possible biological target for antimalarial drugs, specifically the imidazolopiperazine compound GNF179, which can inhibit sey1's GTPase activity .

Deletion of sey1 has been shown to result in pleiotropic phenotypes, including altered ER architecture, impaired lysosomal enzyme exocytosis, reduced intracellular proteolysis, and decreased cell motility, highlighting its importance in multiple cellular pathways .

How is recombinant sey1 protein typically expressed and purified for research purposes?

The expression and purification of recombinant sey1 protein typically follows a standardized protocol optimized for this large GTPase:

Expression System:

  • Most commonly expressed in E. coli expression systems

  • The full-length protein (amino acids 1-764) is typically fused to an N-terminal His tag to facilitate purification

Purification Process:

  • Affinity Chromatography: His-tagged sey1 is initially purified using nickel or cobalt affinity chromatography

  • Size Exclusion Chromatography: Further purification is achieved through gel filtration to separate the protein from aggregates and contaminants

  • Buffer Exchange: The protein is typically exchanged into a Tris/PBS-based storage buffer with 6% trehalose at pH 8.0

Quality Control:

  • Purity assessment via SDS-PAGE (typically >90% purity is required for functional studies)

  • Western blot confirmation using anti-His antibodies

  • Functional assays to confirm GTPase activity

Yield and Storage:

  • Final product is typically provided as a lyophilized powder

  • For long-term storage, reconstitution in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) is recommended

  • Aliquoting and storage at -20°C/-80°C prevents degradation from freeze-thaw cycles

What are the optimal storage and handling conditions for recombinant sey1 protein?

Proper storage and handling of recombinant sey1 protein is critical for maintaining its structural integrity and functional activity:

Storage Recommendations:

Storage ParameterRecommendationNotes
Storage Temperature-20°C/-80°CLong-term storage requires lower temperatures
Buffer CompositionTris/PBS-based buffer with 6% trehalose, pH 8.0Stabilizes protein structure
Physical FormLyophilized powder or aliquoted solutionLyophilized form provides longer shelf life
Glycerol Content5-50% (recommended final concentration: 50%)Prevents freeze-thaw damage
Aliquot SizeBased on single-use requirementsMinimizes freeze-thaw cycles

Handling Guidelines:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% before aliquoting

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Important Considerations:

  • For short-term experiments, maintain working aliquots at 4°C rather than subjecting the protein to multiple freeze-thaw cycles

  • When thawing frozen aliquots, use rapid thawing at room temperature followed by immediate transfer to ice

  • Monitor protein integrity over time using activity assays if stored for extended periods

How does the GTPase activity of sey1 contribute to its cellular functions?

The GTPase activity of sey1 is central to its biological functions through a mechanistic cycle that powers its membrane fusion and remodeling activities:

GTPase Domain Structure and Function:

  • The catalytic GTPase domain contains highly conserved motifs: P-loop, Walker A, Walker B, and guanosine-binding sites

  • These motifs coordinate GTP binding and hydrolysis, converting chemical energy into mechanical force

Mechanistic Cycle:

  • GTP Binding: Induces conformational changes that promote sey1 oligomerization

  • Oligomerization: Enables tethering of opposing membranes (e.g., ER tubules)

  • GTP Hydrolysis: Triggers power stroke that brings membranes into close proximity

  • Phosphate Release: Results in conformational rearrangement that promotes membrane fusion

  • GDP Release: Resets the protein for another cycle

Experimental Evidence:

  • GTP addition stimulates sey1-mediated interactions between cellular structures such as LDs and LCVs

  • Inhibition of sey1's GTPase activity by compounds like GNF179 prevents its normal function in membrane dynamics

  • Surface plasmon resonance experiments demonstrate direct binding of GTP analogs to the GTPase domain

Functional Implications:

  • Deletion of sey1 disrupts ER architecture due to impaired homotypic fusion of ER tubules

  • Mutations in GTP-binding motifs render the protein non-functional, highlighting the essential nature of this activity

  • The GTPase activity provides a druggable target for therapeutic intervention, as demonstrated by antimalarial research

What experimental approaches can be used to study sey1's role in lipid droplet dynamics?

Multiple complementary experimental approaches can be employed to investigate sey1's role in lipid droplet (LD) dynamics:

Cellular and Biochemical Approaches:

  • Subcellular Fractionation and Proteomics:

    • Isolation of purified LDs followed by mass spectrometry to confirm sey1 localization

    • Comparative proteomics between wild-type and Δsey1 mutant LD fractions to identify changes in LD-associated proteins

  • Fluorescence Microscopy:

    • GFP-tagged sey1 constructs to visualize subcellular localization

    • Co-localization with LD markers (e.g., PLIN)

    • Live-cell imaging to track dynamic interactions between sey1-positive structures and LDs

  • In vitro Reconstitution Assays:

    • Purified LDs and recombinant sey1 protein to assess direct interactions

    • GTP-dependency tests using non-hydrolyzable GTP analogs or GTPase-deficient sey1 mutants

    • Membrane fusion assays using fluorescently-labeled synthetic membranes

Genetic and Molecular Approaches:

  • Gene Knockout/Knockdown Studies:

    • Generation of sey1-deficient cell lines to study effects on LD number, size, and composition

    • Phenotypic rescue experiments with wild-type or mutant sey1 constructs

  • Domain Analysis:

    • Truncation or point mutation constructs to identify domains required for LD association

    • Chimeric proteins to investigate domain-specific functions

  • Lipid Analysis:

    • Lipidomics comparison between LDs isolated from wild-type and Δsey1 cells

    • Analysis of fatty acid content and phospholipid composition of LDs

Infection Models:

  • Legionella pneumophila infection assays in wild-type vs. Δsey1 cells to assess LD-LCV interactions

  • Time-course imaging to track LD dynamics during infection

  • Assessment of LCV integrity using cytoplasmic markers like mCherry

How does sey1 deletion affect cellular phenotypes across different model organisms?

Deletion of sey1 produces distinct but related phenotypes across different model organisms, reflecting its conserved but contextually nuanced functions:

In Dictyostelium discoideum:

  • Altered ER architecture with partial disruption of the tubular ER network

  • Preserved macropinocytic and phagocytic functions

  • Impaired lysosomal enzyme exocytosis and intracellular proteolysis

  • Reduced cell motility and compromised growth on bacterial lawns

  • Defective LCV expansion and impaired intracellular replication of Legionella pneumophila

In Yeast Models:

  • Fragmented ER morphology

  • Defects in ER-ER fusion events

  • Synthetic growth defects when combined with mutations in other ER shaping proteins

  • Impact on lipid droplet biogenesis and morphology

In Plasmodium Species:

  • Altered ER morphology upon inhibition of SEY1

  • Compromised parasite viability when SEY1 function is disrupted

  • Resistance to certain antimalarial compounds when SEY1 is overexpressed, suggesting a role in drug mechanisms

Cross-Species Comparison Table:

OrganismER Morphology EffectsLipid Metabolism EffectsGrowth/Viability ImpactSpecial Phenotypes
D. discoideumPartial disruption of tubular ERAltered LD-LCV interactionsCompromised growth on bacterial lawnsImpaired L. pneumophila replication
YeastFragmented ER networkAltered LD biogenesisSynthetic growth defects-
PlasmodiumDisrupted ER structureUnknownReduced viabilityDrug resistance mechanisms

The conserved nature of these phenotypes across evolutionary distance highlights the fundamental importance of sey1 in membrane homeostasis and organelle dynamics, while the variations reflect species-specific adaptations of its function.

What structural features of sey1 make it a potential druggable target?

Several structural characteristics of sey1 contribute to its potential as a druggable target for therapeutic intervention:

Key Druggable Features:

  • Well-Defined GTPase Domain:

    • Contains a druggable catalytic region with conserved motifs (P-loop, Walker A, Walker B, and guanosine-binding sites)

    • The nucleotide-binding pocket provides a specific target for small molecule inhibitors

  • Structural Conservation:

    • High degree of structural conservation across species, as demonstrated by the mirror symmetry between Plasmodium falciparum SEY1 and Candida albicans SEY1 models

    • Conserved structure facilitates cross-species drug development while allowing for selective targeting

  • Essential Cellular Function:

    • Plays crucial roles in ER membrane dynamics and lipid droplet function

    • Deletion or inhibition produces significant cellular phenotypes, suggesting therapeutic potential

  • Demonstrated Binding to Small Molecules:

    • Research has shown that compounds like GNF179 can bind to and inhibit SEY1 GTPase activity

    • Surface plasmon resonance experiments demonstrated elevated levels of GNF179 on PvSEY1-coated sensor chips

Experimental Evidence for Druggability:

  • Molecular docking studies predict binding of inhibitors to conserved GTPase motifs

  • Thermal shift assays show that GNF179 reduces PvSEY1 melting temperature, indicating direct interaction

  • Functional studies confirm that GNF179 inhibits PvSEY1 GTPase activity

  • Genetic studies demonstrate that Plasmodium SEY1 overexpression confers resistance to GNF179, further supporting SEY1 as the drug target

The combination of a well-defined catalytic domain, structural conservation, essential function, and experimental validation makes sey1 a compelling target for drug development, particularly in the context of antimalarial therapeutics.

How can researchers assess the functional integrity of recombinant sey1 protein in vitro?

Multiple complementary assays can be employed to verify the functional integrity of recombinant sey1 protein:

Biochemical Activity Assays:

  • GTPase Activity Assay:

    • Colorimetric measurement of phosphate release using malachite green

    • HPLC-based detection of GDP formation from GTP

    • Real-time monitoring using fluorescent GTP analogs

  • Nucleotide Binding Assays:

    • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of GTP binding

    • Fluorescence-based assays using MANT-GTP or similar fluorescent nucleotide analogs

    • Surface plasmon resonance to measure real-time binding kinetics

Structural Integrity Assessments:

  • Thermal Shift Assays:

    • Differential scanning fluorimetry to determine protein stability and detect ligand binding

    • Changes in melting temperature upon addition of nucleotides or potential inhibitors

  • Limited Proteolysis:

    • Exposure to proteases followed by SDS-PAGE analysis to assess proper folding

    • Properly folded proteins show characteristic digestion patterns

  • Circular Dichroism Spectroscopy:

    • Assessment of secondary structure content

    • Monitoring of thermal unfolding to determine stability

Functional Membrane Interaction Assays:

  • Liposome Tubulation/Fusion Assays:

    • Mixing of fluorescently labeled liposomes with recombinant sey1 to assess fusion activity

    • Electron microscopy visualization of membrane morphology changes

  • GTP-Dependent Oligomerization:

    • Size exclusion chromatography to detect GTP-induced oligomeric states

    • Dynamic light scattering to measure changes in protein complex size

Validation Protocol Flowchart:

  • Initial purity assessment (SDS-PAGE, >90% purity)

  • Basic structural integrity (CD spectroscopy, thermal shift baseline)

  • Nucleotide binding capacity (ITC or fluorescence-based assay)

  • GTPase activity measurement (phosphate release assay)

  • Membrane interaction studies (liposome assays)

These assays collectively provide a comprehensive assessment of recombinant sey1's functional integrity, ensuring that the protein maintains its native properties and activities for downstream applications.

What are the current contradictions or knowledge gaps in sey1 research?

Despite significant advances in understanding sey1 function, several important contradictions and knowledge gaps remain in the field:

Structural Uncertainties:

  • Complete atomic-resolution structure of full-length sey1 including transmembrane domains remains unresolved

  • Structural changes during the GTPase cycle are incompletely characterized

  • Molecular details of how sey1 mediates membrane fusion remain debated

Functional Ambiguities:

  • Lipid Droplet Association:

    • Direct evidence for sey1 localization to LDs shows some inconsistencies across studies

    • The mechanism by which sey1 mediates LD-LCV interactions remains unclear

    • Whether sey1 directly associates with LDs or influences them indirectly via ER contacts is unresolved

  • GTPase Regulation:

    • Factors that regulate sey1 GTPase activity in vivo are poorly characterized

    • Whether sey1 requires cofactors or binding partners for optimal activity is not fully established

    • The rate-limiting step in the GTPase cycle remains debated

  • Drug Targeting Mechanism:

    • While evidence suggests SEY1 as a target for compounds like GNF179, the precise binding mode and inhibition mechanism require further characterization

    • The selectivity of inhibitors between host and pathogen SEY1 orthologs needs clarification

Methodological Challenges:

  • Protein Purification:

    • Obtaining full-length, properly folded sey1 with intact transmembrane domains remains technically challenging

    • Reconstitution into membrane systems while maintaining activity presents difficulties

  • In Vivo Analysis:

    • Distinguishing direct vs. indirect effects of sey1 deletion is complicated by its fundamental role in ER function

    • The pleiotropic effects of sey1 deletion make it difficult to isolate specific functional pathways

Future Research Directions:

  • Development of conditional/inducible knockouts to better dissect temporal requirements for sey1

  • Creation of separation-of-function mutants to distinguish different aspects of sey1 activity

  • Advanced imaging techniques to track sey1 dynamics in real-time

  • Comprehensive interactome analysis to identify sey1 binding partners and regulators

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and genetics to fully elucidate the complex functions of this essential GTPase.

How can researchers utilize recombinant sey1 protein to study membrane fusion mechanisms?

Recombinant sey1 protein provides a powerful tool for investigating membrane fusion mechanisms through various experimental approaches:

In Vitro Reconstitution Systems:

  • Minimal Membrane Fusion Assays:

    • Purified recombinant sey1 incorporated into synthetic liposomes

    • Fluorescence dequenching assays using lipid-mixing indicators (e.g., NBD-PE/Rh-PE pairs)

    • Content-mixing assays using self-quenching fluorophores to distinguish hemifusion from full fusion

  • Real-time Visualization:

    • Total internal reflection fluorescence (TIRF) microscopy to observe single fusion events

    • High-speed atomic force microscopy to track membrane topological changes

    • Cryo-electron microscopy to capture fusion intermediates

Structure-Function Analysis:

  • Mutational Studies:

    • Systematic mutagenesis of GTPase domain residues to identify critical amino acids

    • Creation of GTPase-deficient mutants (e.g., K/A mutations in P-loop)

    • Transmembrane domain alterations to assess membrane anchoring requirements

  • Domain Swapping:

    • Chimeric constructs with other dynamin-like proteins to identify fusion-specific domains

    • Minimal domain constructs to determine sufficiency for membrane interactions

Regulatory Mechanism Investigation:

  • GTPase Cycle Manipulation:

    • Use of non-hydrolyzable GTP analogs (GTPγS, GMPPNP) to trap specific conformational states

    • GDP-AlF₄⁻ to mimic the transition state of GTP hydrolysis

    • Comparison of GTP- vs. GDP-bound states to elucidate conformational changes

  • Interacting Partner Assessment:

    • Co-reconstitution with candidate regulatory proteins

    • Pull-down assays using recombinant sey1 as bait to identify novel interactors

    • Competition assays to map binding interfaces

These approaches collectively provide a comprehensive toolkit for dissecting the molecular mechanisms of sey1-mediated membrane fusion, allowing researchers to bridge structural insights with functional outcomes in this essential cellular process.

What considerations should be made when designing experiments to study sey1 interactions with lipid droplets?

When investigating sey1 interactions with lipid droplets, researchers should consider several critical experimental design factors:

Sample Preparation Considerations:

  • Lipid Droplet Isolation:

    • Purity assessment is crucial to avoid contamination with other membrane structures

    • Documentation of purification steps with clear visualization of enrichment process

    • Validation of LD markers (e.g., PLIN) at each purification stage

  • Cell Culture Conditions:

    • Consider lipid loading protocols (e.g., palmitate supplementation) that may affect results

    • Be aware that continuous treatment with high concentrations of palmitate (e.g., 200μM) may introduce artifacts not present in normal cellular conditions

    • Include appropriate controls to distinguish physiological from pathological states

Technical Approach Selection:

  • Direct vs. Indirect Interactions:

    • Differentiate between direct sey1-LD binding and indirect effects through ER-LD contacts

    • Use multiple complementary approaches (biochemical, imaging, genetic) to corroborate findings

    • Consider proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to sey1

  • Resolution Limitations:

    • Be aware that standard confocal microscopy may not resolve ER-LD contact sites from LD localization

    • Consider super-resolution techniques (STED, PALM/STORM) or electron microscopy for definitive localization

    • Use appropriate controls for fluorescent protein fusions that may affect localization

Experimental Controls and Validations:

  • Protein Expression Levels:

    • Overexpression artifacts can lead to mislocalization

    • Use endogenous tagging approaches when possible

    • Validate findings with antibodies against native protein (when available)

  • Functional Validation:

    • Complement localization studies with functional assays

    • Consider lipid composition analysis of LDs from wild-type vs. Δsey1 cells

    • Perform rescue experiments with wild-type sey1 and specific mutants

  • Alternative Hypotheses Testing:

    • Test competing explanations for observed phenotypes

    • For example, assess LCV integrity during L. pneumophila infection to rule out that LD localization is only with damaged LCVs

    • Use markers like cytoplasmic mCherry to evaluate membrane integrity

By carefully addressing these considerations, researchers can obtain more reliable and physiologically relevant insights into the complex relationship between sey1 and lipid droplet dynamics, avoiding common pitfalls that have led to contradictory findings in the literature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.