Recombinant Schizosaccharomyces pombe 3-ketoacyl-CoA reductase (SPAC4G9.15)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Classification

The SPAC4G9.15 gene encodes a protein officially known as 3-ketoacyl-CoA reductase, commonly abbreviated as KAR or 3-ketoreductase. This enzyme belongs to the short-chain dehydrogenase/reductase family and carries the Enzyme Commission (EC) number 1.1.1.- . The protein is also referred to as "Very-long-chain 3-oxoacyl-CoA reductase" or "Microsomal beta-keto-reductase" in scientific literature, reflecting its functional role in fatty acid metabolism pathways .

Biological Function

The 3-ketoacyl-CoA reductase from Schizosaccharomyces pombe participates in fatty acid elongation pathways, specifically catalyzing the reduction of 3-ketoacyl-CoA intermediates. This reaction represents a critical step in the biosynthesis of very long-chain fatty acids, which are essential components of membrane lipids and cellular signaling molecules. The enzyme utilizes NADPH as a cofactor to reduce the keto group at the beta position of 3-ketoacyl-CoA substrates, yielding 3-hydroxyacyl-CoA products that proceed through subsequent steps in the elongation cycle.

Post-Translational Modifications and Tags

The commercially available recombinant form of SPAC4G9.15 typically includes an N-terminal histidine tag (His-tag), which facilitates protein purification through affinity chromatography methods . This modification does not significantly alter the protein's native activity but provides substantial benefits for isolation and detection purposes. The His-tagged version enables researchers to readily purify the protein using metal affinity resins and detect it using anti-His antibodies in various experimental applications.

Recombinant Expression Systems

The recombinant SPAC4G9.15 protein is predominantly produced using Escherichia coli expression systems . This bacterial host provides several advantages for recombinant protein production, including rapid growth, high protein yields, and well-established genetic manipulation techniques. The protein is typically expressed under the control of strong promoters, such as the T7 promoter system, which enables efficient transcription and translation of the target gene.

Interestingly, research has shown that expression of certain proteins in bacterial systems can have varying effects on host viability. A 2021 study demonstrated that while expression of S. pombe Ire1 kinase/RNase domains caused toxicity to bacterial cells due to promiscuous RNase activity, this mechanism could potentially affect expression of other S. pombe proteins including SPAC4G9.15 .

Purification and Quality Control

Following expression, the His-tagged SPAC4G9.15 protein undergoes purification processes that typically include:

  1. Cell lysis to release the intracellular protein

  2. Affinity chromatography using nickel or cobalt resins

  3. Washing steps to remove contaminants

  4. Elution with imidazole-containing buffers

  5. Additional purification steps as needed (e.g., size exclusion chromatography)

  6. Quality assessment via SDS-PAGE

The purified product generally achieves greater than 90% purity as determined by SDS-PAGE analysis . Following purification, the protein is often lyophilized to enhance stability during storage and transportation.

Physical Properties

The commercially available SPAC4G9.15 recombinant protein is typically supplied as a lyophilized powder, which provides enhanced stability during shipping and long-term storage . Upon reconstitution, the protein adopts its functional three-dimensional conformation in appropriate buffer conditions.

Enzyme Activity Studies

The recombinant SPAC4G9.15 protein serves as a valuable tool for investigating the kinetics and mechanisms of 3-ketoacyl-CoA reductase activity. Researchers can utilize this purified enzyme to:

  1. Determine substrate specificity profiles

  2. Measure reaction kinetics and catalytic parameters

  3. Screen potential inhibitors or activators

  4. Compare functional properties with homologous enzymes from other species

Role in RNA Processing Research

Interestingly, the mRNA encoding SPAC4G9.15 has been utilized in research focused on RNA processing mechanisms. Studies have employed the SPAC4G9.15 mRNA as a substrate to examine the cleavage specificity of Ire1 endoribonuclease, which plays a crucial role in the unfolded protein response .

A 2021 study published in eLife demonstrated that the SPAC4G9.15 mRNA contains a specific cleavage site recognized by S. pombe Ire1. The research revealed that this site features a 3-membered loop with a G|C cleavage motif that is particularly amenable to cleavage by the S. pombe enzyme . This finding highlights how this protein's encoding mRNA serves as a model substrate for investigating RNA processing mechanisms.

ELISA-Based Applications

The recombinant SPAC4G9.15 protein is also employed in Enzyme-Linked Immunosorbent Assay (ELISA) applications, enabling sensitive detection and quantification of protein-protein interactions, antibody binding properties, and other immunological parameters . These applications further expand the utility of this recombinant protein beyond enzymatic activity studies.

Custom Production Options

In addition to standard catalog offerings, custom production services for recombinant SPAC4G9.15 are available with delivery timeframes typically ranging from 4 to 6 weeks . These custom preparations can accommodate specific requirements regarding:

  1. Protein tags (type and position)

  2. Expression systems

  3. Purification methods

  4. Buffer compositions

  5. Concentration requirements

  6. Endotoxin levels

This flexibility allows researchers to obtain protein preparations optimized for their specific experimental needs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
SPAC4G9.15; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC4G9.15
Target Protein Sequence
MDGEVLANKSCCGAVVTAFSVIGIVFTILKFTSFASFVYKTFFAKGVKLSVYGAKKGYWA VVTGATDGIGKEYATQLAMSGFNVVLISRTQEKLDALAKELETVAKVKTRTIAIDYTKTT AETFEKLHQDLVGTPITVLINNVGQSHYMPTSFAETTVKEMDDIMHINCFGTLHTTKAVL SIMLRERQKNEKGPRCLILTMGSFAGLLPSPYLSTYAGSKAFLSNWSASLGEEVKKQGID VWCFNSYLVVSAMSKVRRPTLTIPTPKKFVRAALSSIGLQRGGTNPYISQPYPSHAVMSW SLEQLLGSAKGFVVSQVAAMHLSIRKRALRKEARLQAQNQA
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe 3-ketoacyl-CoA reductase (SPAC4G9.15) is a component of the microsomal membrane-bound fatty acid elongation system. This enzyme is responsible for producing very long-chain fatty acids (VLCFAs), specifically 26-carbon VLCFAs, from palmitate. Its function is to catalyze the reduction of the 3-ketoacyl-CoA intermediate generated in each cycle of fatty acid elongation. These VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe 3-ketoacyl-CoA reductase (SPAC4G9.15)?

SPAC4G9.15 is a protein-coding gene in Schizosaccharomyces pombe (fission yeast) that encodes a ketoreductase enzyme, specifically a 3-ketoacyl-CoA reductase (KCR) . This enzyme functions as one of the four critical components of the fatty acid elongase (FAE) complex located in the endoplasmic reticulum (ER) . The protein product is officially designated as "putative ketoreductase" in the NCBI database under accession number NP_593697.1 . The enzyme catalyzes the second step (reduction) in the four-step cycle of very long-chain fatty acid (VLCFA) biosynthesis, following the condensation reaction catalyzed by 3-ketoacyl-CoA synthase (KCS) .

What is the evolutionary conservation of SPAC4G9.15 across species?

SPAC4G9.15 demonstrates remarkable evolutionary conservation across diverse organisms, indicating its fundamental importance in cellular metabolism. Homologs of this gene are found in a wide range of species spanning multiple kingdoms :

OrganismGene/Protein IdentifierAccession Number
HumansHSD17B12NP_057226.1
MouseHsd17b12NP_062631.1
RatHsd17b12NP_114455.1
Zebrafishhsd17b12a, hsd17b12bNP_957175.1, NP_955907.1
Baker's yeastIFA38NP_009717.1
ArabidopsisKCR1NP_564905.1
RiceOs04g0483500NP_001053125.1
C. eleganslet-767, stdh-1,2,3,4Multiple accessions

This high degree of conservation suggests that the fundamental enzymatic mechanism has been preserved throughout evolution, making S. pombe an excellent model organism for studying the basic functions of this enzyme with implications for higher organisms .

What growth conditions are optimal for culturing S. pombe for SPAC4G9.15 research?

For optimal expression and study of SPAC4G9.15 in S. pombe, researchers should utilize standard fission yeast cultivation methods with appropriate modifications. S. pombe cells should be grown in either YEA (Yeast Extract with Adenine) or EMM (Edinburgh Minimal Medium) supplemented with appropriate nutrients . For basic maintenance, YEA medium is recommended, while for controlled expression studies, EMM with specific supplements allows for better regulation of experimental conditions.

A standard growth protocol includes:

  • Pre-culture in 5 ml YEA medium at 30°C for 24 hours with shaking at 180-200 rpm

  • Dilution to OD600 of 0.2 in fresh medium

  • Growth to mid-log phase (OD600 of 0.5-0.8)

  • Harvesting by centrifugation at 3,000 × g for 5 minutes

  • Washing with sterile water or appropriate buffer before experimental procedures

For strains carrying plasmids with selectable markers, appropriate selection media should be used to maintain the recombinant constructs .

What are the basic techniques for isolating and purifying recombinant SPAC4G9.15?

The isolation and purification of recombinant SPAC4G9.15 requires a systematic approach to maximize yield and enzyme activity:

  • Cell Lysis Protocol:

    • Harvest cells at mid-log phase (OD600 0.6-0.8)

    • Wash with cold PBS

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, 10% glycerol)

    • Add protease inhibitor cocktail

    • Lyse cells using glass beads or enzymatic methods

    • Centrifuge at 15,000 × g for 20 minutes at 4°C to remove debris

  • Protein Purification Strategy:

    • For His-tagged constructs: Ni-NTA affinity chromatography

    • For GST-tagged constructs: Glutathione Sepharose affinity purification

    • Further purification using ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Activity Preservation:

    • Store purified enzyme in buffer containing 20% glycerol

    • Flash freeze aliquots in liquid nitrogen

    • Store at -80°C for long-term preservation

Validation of the purified enzyme should include SDS-PAGE analysis, Western blotting, and activity assays measuring the reduction of 3-ketoacyl-CoA substrates.

How can experimental design principles be applied to study SPAC4G9.15 function?

Robust experimental design is crucial for investigating SPAC4G9.15 function. Based on established design principles, researchers should consider implementing the following approaches :

  • Completely Randomized Design:

    • Randomly assign different SPAC4G9.15 mutant strains to various treatment conditions

    • Include appropriate replicates (minimum n=3) for statistical validity

    • Control for confounding variables such as culture age, media composition, and temperature

    • Example application: Testing enzymatic activity of wild-type vs. mutant SPAC4G9.15 under varying substrate concentrations

  • Randomized Block Design:

    • Group experimental units into blocks based on known variability factors

    • Example application: When studying SPAC4G9.15 expression across different genetic backgrounds, block by strain derivation to control for genetic variation

    • This design reduces within-treatment variability, enhancing the ability to detect treatment effects

  • Matched Pairs Design:

    • Particularly useful for comparing isogenic strains differing only in SPAC4G9.15 expression

    • Example application: Wild-type strain paired with SPAC4G9.15 deletion strain, with each pair subjected to identical environmental stressors

    • Reduces experimental error by controlling for variation between experimental units

Each experimental design should address the three core purposes outlined in statistical literature :

  • Causation: Establishing causal relationships between SPAC4G9.15 modifications and phenotypic outcomes

  • Control: Eliminating alternative explanations through careful control of extraneous variables

  • Variability: Minimizing within-treatment variability to enhance statistical power

What methodologies are recommended for analyzing SPAC4G9.15 gene expression?

For comprehensive analysis of SPAC4G9.15 gene expression patterns, researchers should employ multiple complementary techniques:

  • Quantitative Real-Time PCR (qRT-PCR):

    • Design primers specific to SPAC4G9.15 with amplicon size of 100-200 bp

    • Normalize expression using at least three stable reference genes (e.g., act1, cdc2, rpb1)

    • Perform reactions in technical triplicates and biological quadruplicates

    • Calculate relative expression using the 2^(-ΔΔCt) method

  • RNA-Seq Analysis:

    • Sequence depth of at least 20 million reads per sample

    • Analyze differential expression using DESeq2 or edgeR

    • Validate key findings using qRT-PCR

    • Examine co-expression patterns with other fatty acid metabolism genes

  • Promoter Analysis:

    • Identify cis-acting elements in the SPAC4G9.15 promoter region

    • Similar to other genes in this pathway, look for elements related to growth, stress response, and metabolic regulation

    • Use reporter constructs to validate functional elements

For expression studies under stress conditions, researchers should systematically vary parameters such as temperature, nutrient availability, and chemical stressors, as has been done with cadmium stress in similar studies of KCS genes in rice .

How can structure-function relationships be established for SPAC4G9.15?

Establishing structure-function relationships for SPAC4G9.15 requires a multidisciplinary approach:

  • Homology Modeling and Structural Analysis:

    • Generate homology models based on crystal structures of related KCR enzymes

    • Identify conserved domains through sequence alignment with homologs like human HSD17B12 (NP_057226.1) and Arabidopsis KCR1 (NP_564905.1)

    • Predict substrate binding sites and catalytic residues

    • Use molecular dynamics simulations to assess conformational flexibility

  • Site-Directed Mutagenesis Strategy:

    • Target predicted catalytic residues and substrate binding sites

    • Create a library of single amino acid substitutions

    • Assess effects on:

      • Enzyme kinetics (Km, Vmax, kcat)

      • Substrate specificity

      • Protein stability

      • In vivo function through complementation assays

  • Functional Validation:

    • Express wild-type and mutant versions in heterologous systems

    • Perform in vitro enzymatic assays using purified proteins

    • Conduct in vivo complementation studies in S. pombe KCR deletion strains

    • Analyze fatty acid profiles using GC-MS or LC-MS/MS

This systematic approach allows researchers to correlate specific structural features with enzymatic properties and cellular functions.

How can SPAC4G9.15 be studied in the context of the complete fatty acid elongation pathway?

To understand SPAC4G9.15 in the broader context of fatty acid elongation, researchers should implement integrated approaches:

  • Metabolic Flux Analysis:

    • Use isotope-labeled precursors (e.g., 13C-labeled acetyl-CoA)

    • Track incorporation into VLCFAs using mass spectrometry

    • Quantify metabolic flux through the elongation pathway

    • Compare flux patterns between wild-type and SPAC4G9.15 mutant strains

  • Interaction Studies with Other FAE Components:

    • Investigate protein-protein interactions between SPAC4G9.15 and other FAE complex components

    • Methods include:

      • Co-immunoprecipitation

      • Yeast two-hybrid assays

      • Bimolecular fluorescence complementation (BiFC)

      • Proximity labeling techniques

  • Integrated Analysis of Fatty Acid Elongation:

    • Perform lipidomic profiling to quantify VLCFA composition

    • Correlate enzyme activity with lipid profiles

    • Analyze coordinated expression of all four FAE enzymes under various conditions

This ecosystem approach provides insights into how SPAC4G9.15 functions within the complete elongation machinery rather than in isolation, revealing regulatory mechanisms and rate-limiting steps in the pathway .

What approaches are recommended for investigating the regulation of SPAC4G9.15?

Understanding the regulation of SPAC4G9.15 requires examination at multiple levels:

  • Transcriptional Regulation:

    • Identify transcription factors binding to the SPAC4G9.15 promoter using:

      • Chromatin immunoprecipitation (ChIP)

      • Electrophoretic mobility shift assays (EMSA)

      • Promoter deletion/mutation analyses with reporter genes

    • Analyze promoter elements similar to those found in other metabolic genes (stress-responsive elements, growth-related elements)

  • Post-transcriptional Regulation:

    • Investigate mRNA stability using actinomycin D chase experiments

    • Assess potential regulation by microRNAs

    • Examine alternative splicing patterns under different conditions

  • Post-translational Modifications (PTMs):

    • Use mass spectrometry to identify PTMs such as:

      • Phosphorylation

      • Acetylation

      • Ubiquitination

    • Determine how these modifications affect:

      • Enzyme activity

      • Protein localization

      • Protein-protein interactions

      • Protein stability

  • Regulation Under Stress Conditions:

    • Similar to studies in rice where KCS genes showed differential responses to cadmium stress , examine SPAC4G9.15 regulation under:

      • Oxidative stress

      • Nutrient limitation

      • Temperature shifts

      • Membrane-disrupting agents

Implementing these approaches will provide a comprehensive understanding of the regulatory mechanisms controlling SPAC4G9.15 expression and activity in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.