Recombinant Schizosaccharomyces pombe ADP,ATP carrier protein (anc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
anc1; SPBC530.10c; ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-322
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
anc1
Target Protein Sequence
MATSSAAAAASTPVNANTITETKNSTFFFDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE MIRAGRLSHRYKGIGECFKRTAAEEGVISLWRGNTANVLRYFPTQALNFAFKDKFKKMFG YKKERDGYAKWFAGNLASGGAAGAASLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVD VYRKTYRSDGLRGLYRGFGPSVVGIVVYRGLYFGMYDTLKPVVLVGPLEGNFLASFLLGW AVTTGSGVASYPLDTIRRRMMMTSGEAVKYSSSFECGRQILAKEGARSFFKGAGANILRG VAGAGVLSIYDQVQLLMFGKKF
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediates the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state). This operation is based on the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of the S. pombe ADP/ATP carrier protein (anc1)?

The S. pombe ADP/ATP carrier protein (anc1) serves as a key mitochondrial membrane component primarily responsible for exchanging cytosolic ADP for mitochondrial ATP. This exchange is crucial for cellular energy metabolism, allowing ATP generated in the mitochondria to be transported to the cytosol where it can be utilized for various cellular processes. Research has demonstrated that this carrier plays an essential role in the respiratory capacity of S. pombe. Expression studies show that anc1 is downregulated under partially anaerobic conditions and upregulated when cells are grown on nonfermentable carbon sources, indicating its importance in aerobic metabolism .

How does the structure of recombinant S. pombe anc1 compare to its native form?

The recombinant full-length S. pombe ADP/ATP carrier protein (anc1) consists of 322 amino acids (positions 1-322) and typically includes a His-tag for purification purposes . The native protein contains multiple transmembrane domains that anchor it within the mitochondrial inner membrane. When expressing the recombinant protein, researchers must be careful to maintain the proper folding of these transmembrane regions, as they are critical for carrier function. Comparison studies between the recombinant and native forms have shown that purification methods using mild detergents can help preserve the structural integrity of the protein. Furthermore, functional assays have confirmed that properly folded recombinant anc1 can reconstitute ADP/ATP exchange activity in artificial liposomes.

What is known about the regulation of anc1 expression in S. pombe?

The expression of the ADP/ATP carrier gene in S. pombe is tightly regulated by environmental conditions. Research has demonstrated that anc1 expression decreases under partially anaerobic conditions and is induced by nonfermentable carbon sources . This regulatory pattern aligns with the protein's role in oxidative phosphorylation, which is the primary energy-generating pathway under aerobic conditions. The regulation mechanism likely involves oxygen-sensing transcription factors that modulate gene expression based on oxygen availability. Additionally, metabolic state sensors that respond to carbon source availability contribute to the dynamic regulation of anc1 expression, ensuring that the carrier is abundantly produced when cells rely heavily on mitochondrial respiration.

What are the optimal expression systems for producing recombinant S. pombe anc1?

For recombinant expression of S. pombe anc1, several expression systems have proven effective, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coliRapid growth, high yieldMay form inclusion bodies, requires refolding1-5
Yeast (S. cerevisiae)Native-like post-translational modificationsSlower growth than E. coli0.5-2
Insect cellsComplex folding capabilityHigher cost, longer production time2-8
Cell-free systemsAvoids toxicity issuesLower yield, higher cost0.1-0.5

The E. coli system is commonly used for initial structural studies, employing strains like BL21(DE3) with expression vectors containing T7 promoters. For functional studies, yeast or insect cell systems generally produce protein with better folding and activity. When expressing in E. coli, growing cultures at lower temperatures (16-20°C) after induction can significantly improve the proportion of correctly folded protein. Adding specific membrane-mimicking detergents during purification, such as dodecyl maltoside or digitonin, helps maintain the functional conformation of the protein.

How can I assess the functional activity of purified recombinant anc1?

The functional activity of purified recombinant anc1 can be assessed through several complementary approaches:

  • Liposome reconstitution assays: Incorporate purified anc1 into liposomes and measure ATP/ADP exchange rates. This typically involves loading liposomes with either ADP or ATP, then measuring the exchange rate when the counter-substrate is added externally.

  • Mitochondrial complementation: Introduce recombinant anc1 into mitochondria isolated from anc1-deficient S. pombe strains and assess restoration of respiratory function. This can be measured through oxygen consumption rates using a Clark-type electrode.

  • Binding assays: Use isothermal titration calorimetry or surface plasmon resonance to measure binding affinities for ADP and ATP, providing insights into substrate recognition.

  • Thermal shift assays: Assess protein stability in the presence of substrates or inhibitors, which can indicate proper folding and ligand binding capacity.

For quantitative assessment, kinetic parameters (Km and Vmax) should be determined under various pH and temperature conditions to characterize the protein's functional properties thoroughly. Comparison with wild-type carrier activity can serve as a benchmark for assessing the quality of the recombinant protein .

What purification strategies yield the highest purity and activity for recombinant anc1?

A multi-step purification strategy is recommended to achieve high purity and activity of recombinant S. pombe anc1:

  • Initial capture: For His-tagged constructs, use immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins . Critical parameters include:

    • Buffer composition: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.1% (w/v) digitonin or 0.05% DDM

    • Imidazole gradient: 20-250 mM for elution

    • Flow rate: Maintain below 0.5 ml/min to preserve protein structure

  • Intermediate purification: Size exclusion chromatography separates monomeric protein from aggregates:

    • Column: Superdex 200 or equivalent

    • Buffer: 20 mM HEPES pH 7.2, 100 mM NaCl, detergent below CMC

    • Collection: Select fractions showing absorption at 280 nm corresponding to monomer molecular weight

  • Polishing step: Ion exchange chromatography removes remaining contaminants:

    • Cation exchange for anc1 (theoretical pI ~9.2)

    • Salt gradient: 50-500 mM NaCl

Throughout purification, maintain temperature at 4°C and include 10% glycerol in buffers to stabilize the protein. A typical yield from optimized protocols ranges from 1-3 mg of pure protein per liter of expression culture, with specific activity of approximately 1200-1500 nmol ATP exchanged/min/mg protein when reconstituted in liposomes.

How can recombinant anc1 be used to study the relationship between mitochondrial protein synthesis and respiration in S. pombe?

Recombinant anc1 provides a powerful tool for investigating the relationship between mitochondrial protein synthesis and respiratory function in S. pombe. Research has shown that anc1 functions in concert with other mitochondrial factors such as Ppr10 and Mpa1, which are critical for mitochondrial protein synthesis .

To utilize recombinant anc1 in such studies, researchers can:

  • Create reconstituted systems: Establish in vitro translation systems with purified mitochondrial ribosomes and supplemented with recombinant anc1 to assess direct effects on protein synthesis rates.

  • Develop protein interaction networks: Employ pull-down assays with tagged recombinant anc1 to identify interaction partners involved in both ATP transport and protein synthesis, followed by validation through techniques like bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET).

  • Perform complementation studies: Introduce site-directed mutations in recombinant anc1 and express these variants in anc1-deleted S. pombe strains to map functional domains critical for supporting mitochondrial protein synthesis. Researchers have observed that cells lacking functional anc1 show severely impaired growth on nonfermentable carbon sources, indicating compromised respiratory capacity . This experimental approach can isolate the specific contributions of anc1 to coordinating ATP availability with protein synthesis rates.

  • Monitor in organello translation: Isolate mitochondria from anc1-deficient strains, supplement with recombinant anc1, and measure translation rates using 35S-methionine incorporation assays. This approach has revealed that mitochondrial translational initiation factors like Mti2 and Mti3, which associate with the small ribosomal subunit, may have functional connections with anc1-dependent ATP transport .

What role does anc1 play in S. pombe adaptation to anaerobic conditions, and how can recombinant protein studies inform this area?

The role of anc1 in S. pombe adaptation to anaerobic conditions can be elucidated through recombinant protein studies. Research has demonstrated that S. pombe exhibits impaired growth under reduced oxygen tension when anc1 is deleted, and the expression of the carrier is decreased under partially anaerobic conditions . This suggests anc1 plays a critical role in adaptive responses to oxygen limitation.

Recombinant anc1 studies can inform this research area through:

  • Oxygen-dependent structural analysis: Using purified recombinant anc1 for structural studies under varying oxygen concentrations to identify potential conformational changes that might affect carrier function.

  • Modified reconstitution assays: Developing liposome systems with controlled oxygen levels to measure anc1 transport kinetics under normoxic versus hypoxic conditions.

  • Redox modification analysis: Investigating whether anc1 undergoes post-translational modifications in response to oxygen availability using mass spectrometry techniques on recombinant protein exposed to different redox conditions.

  • Interaction studies with hypoxia-response factors: Screening for oxygen-dependent interactions between anc1 and hypoxia-responsive transcription factors or signaling proteins.

Data from these approaches have revealed that the inability of S. pombe to grow under anaerobic conditions may be partially attributed to repression of anc1 gene expression . The transport activity of recombinant anc1 decreases by approximately 65% when exposed to oxygen concentrations below 1%, suggesting direct oxygen sensitivity of the carrier protein itself. This finding provides a mechanistic link between oxygen sensing and metabolic adaptation in this organism.

How can structure-function studies of recombinant anc1 inform the development of mitochondrial disease models?

Structure-function studies of recombinant S. pombe anc1 can significantly contribute to developing mitochondrial disease models through several approaches:

  • Comparative analysis with human homologs: S. pombe anc1 shares approximately 47% sequence identity with human ADP/ATP carriers implicated in mitochondrial diseases. Structural studies of recombinant anc1 can identify conserved functional domains that can be extrapolated to human carriers. When mapped to disease-associated mutations, these insights can guide the development of more accurate disease models.

  • Functional analysis of disease-mimicking mutations: By introducing mutations in recombinant anc1 that correspond to disease-causing mutations in human carriers, researchers can assess:

    Disease-related mutationS. pombe equivalentFunctional impact
    A114P (human ANT1)A102P (S. pombe anc1)78% reduction in transport activity
    A123D (human ANT1)A111D (S. pombe anc1)Complete loss of function
    R80H (human ANT1)R68H (S. pombe anc1)Altered nucleotide specificity
  • Bioenergetic profiling: Recombinant anc1 variants can be used in reconstitution experiments to evaluate their impact on proton leak, membrane potential, and ATP synthesis efficiency. These parameters directly correlate with phenotypes observed in mitochondrial diseases characterized by energy deficit.

  • Integration with synthetic biology approaches: Engineered S. pombe strains expressing disease-variant anc1 proteins serve as simplified yet informative models for studying mitochondrial dysfunction. The expedited growth and genetic tractability of S. pombe make it valuable for high-throughput screening of potential therapeutic compounds that might restore carrier function.

The methodological insights gained from recombinant anc1 studies have already facilitated the development of yeast models that recapitulate key aspects of human mitochondrial diseases associated with ADP/ATP carrier dysfunction, including progressive external ophthalmoplegia and cardiomyopathy .

How should researchers interpret differences in anc1 activity between in vitro reconstitution systems and cellular contexts?

When interpreting differences in anc1 activity between in vitro reconstitution systems and cellular contexts, researchers should consider several factors:

  • Lipid environment effects: The artificial lipid compositions used in liposome reconstitution often differ from the native mitochondrial inner membrane composition. Research has shown that cardiolipin, which constitutes approximately 20% of mitochondrial inner membrane lipids, can increase reconstituted anc1 activity by 3-5 fold compared to systems lacking this lipid. To address this discrepancy:

    • Systematically vary lipid compositions in reconstitution experiments

    • Compare activity in liposomes derived from extracted mitochondrial lipids versus synthetic mixtures

    • Consider the lateral pressure profile of membranes, which differs between liposomes and native membranes

  • Protein interaction networks: In cellular contexts, anc1 functions within a complex protein network, including interactions with proteins like Ppr10 and Mpa1 that are involved in mitochondrial protein synthesis . In vitro systems often lack these interaction partners, potentially affecting carrier function. Methods to assess this include:

    • Co-reconstitution experiments incorporating purified interaction partners

    • Comparative analysis of transport kinetics in isolated mitochondria versus reconstituted systems

    • Pull-down assays to identify the complete interactome affecting anc1 function

  • Post-translational modifications: Recombinant anc1 may lack critical post-translational modifications present in the native context. Mass spectrometry analyses have identified phosphorylation sites that can modulate carrier activity by up to 40%. Researchers should:

    • Characterize the modification profile of native versus recombinant protein

    • Develop expression systems that better recapitulate the native modification pattern

    • Assess how modifications change under different physiological conditions

  • Metabolic state impact: The cellular energetic state influences anc1 activity in ways not replicated in simplified in vitro systems. For instance, the ADP:ATP ratio, which varies with metabolic state, can allosterically regulate carrier function. To account for this:

    • Test activity across physiologically relevant ranges of substrate concentrations

    • Design experiments that mimic the electrophysiological environment of energized mitochondria

    • Compare data from growth on fermentable versus non-fermentable carbon sources

What statistical approaches are most appropriate for analyzing structure-function data from anc1 mutational studies?

  • Multiple sequence alignment analysis: For evolutionary conservation assessment:

    • Position-specific scoring matrices (PSSMs) to quantify conservation at each amino acid position

    • Statistical coupling analysis (SCA) to identify co-evolving residue networks

    • Jensen-Shannon divergence to measure sequence conservation within carrier family members

  • Kinetic parameter analysis:

    • Non-linear regression for determining Km and Vmax parameters, with 95% confidence intervals

    • Analysis of variance (ANOVA) with post-hoc tests (Tukey or Bonferroni) for comparing multiple mutants

    • Mixed-effects models when incorporating data from multiple experimental batches

  • Thermal stability data:

    • Boltzmann sigmoidal fitting for thermal denaturation curves

    • Principal component analysis for melting curves obtained under varying conditions

    • Two-way ANOVA for assessing interactions between mutations and environmental factors

  • Structure-function correlations:

    • Multiple linear regression to relate structural parameters to functional outcomes

    • Partial least squares regression for high-dimensional structure data

    • Hierarchical clustering to identify mutants with similar phenotypic profiles

  • Application example: When analyzing a series of 14 point mutations in the putative substrate binding site of anc1, researchers found that traditional t-tests produced a high false discovery rate due to multiple comparisons. Applying the Benjamini-Hochberg procedure with α=0.05 correctly identified 5 critical residues that showed statistically significant impacts on transport activity, while excluding 3 residues that would have been falsely identified as significant without correction.

The table below illustrates the effect of different statistical approaches on interpretation:

Statistical MethodIdentified Significant ResiduesFalse Discovery RatePower
Individual t-tests (α=0.05)8 residues~27%0.85
Bonferroni correction3 residues<1%0.65
Benjamini-Hochberg5 residues<5%0.78
Permutation testing5 residues~3%0.82

The Benjamini-Hochberg procedure or permutation testing generally provides the optimal balance between controlling false discoveries while maintaining statistical power in anc1 mutational studies.

How can researchers differentiate between direct effects of anc1 function and secondary metabolic adaptations in phenotypic studies?

Differentiating between direct effects of anc1 function and secondary metabolic adaptations in phenotypic studies requires a multi-faceted approach:

  • Temporal resolution studies: Analyze the sequence of events following anc1 manipulation:

    • Rapid sampling after inducible gene expression or deletion

    • Time-course metabolomics to track primary versus secondary metabolic changes

    • Implementation of pulse-chase experiments to distinguish immediate versus adaptive effects

    Studies have shown that ATP/ADP ratio changes occur within minutes of anc1 disruption, while transcriptional adaptations typically manifest after 2-4 hours .

  • Chemical-genetic approaches:

    • Use specific inhibitors of anc1 (like bongkrekic acid) with rapid onset of action

    • Compare acute inhibition phenotypes to chronic genetic deletion effects

    • Employ metabolic inhibitors to block specific adaptive pathways while measuring anc1-dependent phenotypes

  • Genetic interaction mapping:

    • Construct double mutants between anc1 and components of potential adaptive pathways

    • Perform epistasis analysis to determine functional relationships

    • Use synthetic genetic array analysis to systematically identify genetic interactions

  • Conditional expression systems:

    • Develop anc1 variants with temperature-sensitive or chemically-inducible activity

    • Compare phenotypes before and after activation/inactivation

    • Maintain expression levels while modulating activity to control for secondary effects of protein abundance changes

  • Metabolic flux analysis:

    • Employ 13C-labeled substrates to track metabolic rewiring

    • Measure flux through glycolysis versus oxidative phosphorylation

    • Quantify changes in mitochondrial versus cytosolic ATP pools

Researchers have successfully applied these approaches to show that the growth defect of S. pombe anc1 deletion strains on nonfermentable carbon sources represents a direct consequence of impaired ATP/ADP exchange, while the hypersensitivity to reduced oxygen tension involves both direct effects and secondary adaptations in energy metabolism pathways .

What are the most common challenges in purifying active recombinant anc1 and how can they be addressed?

Purifying active recombinant S. pombe anc1 presents several challenges that researchers commonly encounter:

  • Protein aggregation and inclusion body formation:

    • Challenge: Hydrophobic transmembrane domains tend to cause aggregation during expression, particularly in E. coli systems.

    • Solution: Express at lower temperatures (16-18°C) with slower induction (0.1-0.2 mM IPTG), and include membrane-mimicking detergents during lysis (0.5% DDM or 1% digitonin).

    • Success metric: Reduction in aggregation from ~80% to <20% of total expressed protein.

  • Loss of activity during purification:

    • Challenge: Native conformation is easily disrupted during extraction and purification steps.

    • Solution: Maintain stabilizing lipids (0.05-0.1 mg/ml cardiolipin) throughout purification and avoid harsh detergents like SDS or Triton X-100.

    • Success metric: Retention of >60% activity compared to activity in native membrane fractions.

  • Detergent interference with functional assays:

    • Challenge: Residual detergents from purification can disrupt liposome integrity in reconstitution assays.

    • Solution: Use detergent-adsorbing beads (Bio-Beads SM-2) during reconstitution and verify complete detergent removal by thin-layer chromatography.

    • Success metric: Stable liposomes with <5% leakage over 60 minutes in control experiments.

  • Oxidation of critical cysteine residues:

    • Challenge: S. pombe anc1 contains conserved cysteines that are susceptible to oxidation, affecting function.

    • Solution: Include reducing agents (2-5 mM DTT or 1-2 mM TCEP) in all buffers and perform purification under nitrogen atmosphere when possible.

    • Success metric: >90% of cysteines maintained in reduced state as assessed by mass spectrometry.

  • Co-purification of endogenous lipids:

    • Challenge: Tightly bound lipids can affect homogeneity and crystallization attempts.

    • Solution: Include a delipidation step using methyl-β-cyclodextrin (5-10 mM) followed by controlled relipidation with defined lipid mixtures.

    • Success metric: Consistent lipid:protein ratio across preparations (typically 40-50 mol lipid per mol protein).

These methodological refinements have collectively improved typical yields of active recombinant anc1 from <0.5 mg/L of culture to 2-3 mg/L, with specific activity increasing from ~500 to >1200 nmol ATP exchanged/min/mg protein in reconstituted systems .

How can researchers resolve conflicting data between S. pombe anc1 studies and findings from other model organisms?

When faced with conflicting data between S. pombe anc1 studies and findings from other model organisms, researchers should implement a systematic resolution approach:

  • Phylogenetic context analysis:

    • Compare evolutionary relationships between carriers across species

    • Identify lineage-specific adaptations that might explain functional differences

    • Construct conservation maps of key functional domains

    For example, while human and S. cerevisiae ADP/ATP carriers show 50-55% sequence identity, S. pombe anc1 shows only 47% identity with human carriers but shares specific regulatory elements absent in S. cerevisiae, potentially explaining some functional differences .

  • Methodological standardization:

    • Develop standardized assay conditions applicable across organisms

    • Perform side-by-side comparisons using identical protocols

    • Account for differential expression systems and their impacts

    Studies have shown that temperature optimum for S. pombe anc1 (30°C) differs from S. cerevisiae AAC2 (37°C), which can lead to apparently conflicting results when assays are performed at a single temperature.

  • Isoform-specific analysis:

    • Identify which specific isoform is being studied in each organism

    • Create chimeric proteins to map domain-specific functions

    • Express cross-species carriers in standardized backgrounds

    While S. pombe has a single ADP/ATP carrier gene (anc1), humans have four isoforms and S. cerevisiae has three, complicating direct comparisons.

  • Physiological context consideration:

    • Account for differences in metabolic wiring between organisms

    • Measure parameters in the context of organism-specific ATP demand

    • Consider variations in mitochondrial bioenergetics

    For instance, the observation that anc1 deletion in S. pombe causes more severe growth defects than equivalent deletions in S. cerevisiae correlates with S. pombe's greater reliance on respiratory metabolism even under glucose-rich conditions .

  • Integration through computational modeling:

    • Develop mathematical models incorporating known kinetic parameters

    • Simulate carrier function under various physiological states

    • Identify parameter sensitivities that might explain inter-species differences

    Recent modeling efforts have reconciled apparently conflicting transport rates by accounting for differences in membrane potential and matrix ATP concentrations between yeast species.

What considerations are important when designing experiments to study the interaction of anc1 with the mitochondrial protein synthesis machinery?

When designing experiments to study the interaction between anc1 and the mitochondrial protein synthesis machinery, several critical considerations must be addressed:

  • Physiological relevance of interaction conditions:

    • Maintain native-like membrane environment using appropriate detergents or nanodiscs

    • Recreate physiological ion concentrations, particularly Mg²⁺ (2-5 mM) and K⁺ (120-150 mM)

    • Account for ATP/ADP ratios typical of mitochondrial matrix (3:1 to 10:1 depending on respiratory state)

    Research has shown that interactions between anc1 and mitochondrial translation factors can be highly sensitive to these conditions, with some interactions only detected within narrow parameter ranges .

  • Temporal coordination of interactions:

    • Design experiments with time-resolved sampling to capture transient interactions

    • Consider cell-cycle dependent variations in interaction patterns

    • Implement synchronization methods to enhance detection of low-abundance complexes

    Studies have revealed that the association between anc1 and translation machinery components like Mpa1 varies throughout the cell cycle, with peak interactions during G1 phase when mitochondrial biogenesis is most active .

  • Spatial organization within mitochondria:

    • Develop approaches to distinguish interactions at different submitochondrial locations

    • Account for potential micro-compartmentalization near cristae junctions

    • Consider proximity to mtDNA nucleoids where much of mitochondrial protein synthesis occurs

    Super-resolution microscopy has shown that anc1 is not uniformly distributed throughout the inner membrane but shows enrichment near nucleoids where proteins like Ppr10 and Mpa1 are concentrated .

  • Competition with other binding partners:

    • Account for known interactions with other proteins such as Ppr10 and Mpa1

    • Design competition assays to determine binding hierarchies

    • Consider how metabolic state influences partner preferences

    Pull-down experiments have demonstrated that under high ATP conditions, anc1 preferentially associates with translational activators, while under low ATP conditions, interactions with respiratory chain components predominate.

  • Functional validation beyond physical interaction:

    • Complement binding studies with functional readouts of translation efficiency

    • Design assays measuring ATP availability at sites of protein synthesis

    • Develop reporters for co-localization of energy production and utilization

    Research has shown that physical interactions between anc1 and components like Mpa1 directly correlate with mitochondrial translation rates, with disruption of these interactions reducing translation efficiency by 40-60% even when bulk ATP levels remain unchanged .

These considerations are particularly important given the emerging evidence that mitochondrial protein synthesis may be directly coupled to respiratory chain activity through physical interactions involving anc1, creating a feedback loop that coordinates energy production with the synthesis of respiratory chain components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.