Recombinant Schizosaccharomyces pombe Alkaline phosphatase (SPBC14F5.13c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Should you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
SPBC14F5.13c; Alkaline phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC14F5.13c
Target Protein Sequence
MASERDPLLPVHGEGPESPSRRNWKTWIKHGILLILVLSTVIFFYFFSSHKSKGTNEKPK FVIMMVSDGMGPGSLSMTRSFVETLNDKEGYRLPLDEHLIGSSRTRSSSSLITDSAAGAT AFSCANKTYNGAVGVLDNEKPCGTILEAAKEAGYLTGIVVTSRVTDATPASFSAHAANRF MQDLIAEYQVGMGPLGRSVDLLFGGGLCSFLPKSTYRSCRSDNLDLLKYARKKEGFQILL NRTDFDELSNAQLPLLGLFSDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKG FFLLIEGSRIDMASHNNDPIAHVYEVMEYNRAFEIASAFVEKNGGSLISTSDHETGGLTV GRQVSKKYPEYLWKPQVLSLALHSIEYLASAIVNHNQNTLLPYIEQFVLPAIGIPDPNPK QIHDIYVARHNIFNLINVLSDIVSVEAQIGWTTHGHTAVDVNVYGVGEVTEHLRGNMENI EIGQFMEIYLNVSLSDVTEKLKDAPIHGAPDRPSLVETSFSDRLVGFGADLF
Uniprot No.

Target Background

Gene References Into Functions
  1. Isp6p and Psp3p, localized to the vacuole, participate in the proteolytic processing of carboxypeptidase Y and alkaline phosphatase. (PMID: 21153812)
Database Links
Protein Families
Alkaline phosphatase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the cellular localization of Pho8 in Schizosaccharomyces pombe?

In S. pombe, Pho8 is a membrane-tethered and processed glycoprotein that primarily resides in the vacuole. The protein undergoes post-translational processing but maintains its membrane association even after processing. This vacuolar localization is critical for its normal physiological function and distinguishes it from some other alkaline phosphatases that may be secreted or localized to different cellular compartments .

How does the structure of S. pombe Pho8 compare to alkaline phosphatases from other organisms?

S. pombe Pho8 belongs to a well-characterized family of proteins that bind multiple zinc ions for catalytic activity. While sharing the core catalytic mechanism with other alkaline phosphatases, the S. pombe variant has specific structural features adapted to the fission yeast cellular environment. The protein undergoes glycosylation and processing to achieve its mature form, which is essential for proper enzymatic activity. The zinc-binding domains are particularly conserved across species, reflecting their critical role in the catalytic mechanism .

What are the basic enzymatic properties of S. pombe Pho8?

S. pombe Pho8 exhibits typical alkaline phosphatase activity, catalyzing the hydrolysis of phosphate esters under alkaline conditions. The enzyme shows a strong dependency on zinc availability for catalytic activity. Biochemical analysis demonstrates that Pho8 is active when zinc is plentiful and becomes inactive when zinc is limited. Kinetic studies reveal that the enzyme follows standard Michaelis-Menten kinetics with substrate hydrolysis rates that can be affected by environmental factors, particularly metal ion availability .

How does zinc availability affect Pho8 expression and activity in S. pombe?

Zinc availability has a complex effect on Pho8 in S. pombe. When zinc is plentiful, Pho8 shows significantly higher enzymatic activity. Paradoxically, under zinc-limited conditions, higher levels of pho8 mRNAs and Pho8 protein actually accumulate in the cells, despite showing reduced activity. This inverse relationship between expression and activity highlights a sophisticated regulatory mechanism. Specifically, alkaline phosphatase activity is approximately 2-fold higher in zinc-replete wild-type cells compared to zinc-limited cells. This activity can be rapidly restored when zinc is resupplied to previously zinc-deficient cells, even when protein synthesis is blocked by cycloheximide .

What is the relationship between pho8 gene expression and Pho8 protein activity?

There is an inverse relationship between pho8 mRNA levels and Pho8 enzymatic activity in S. pombe. Under zinc-deficient conditions, pho8 mRNA and Pho8 protein levels increase, while the enzymatic activity decreases. This suggests that S. pombe cells might upregulate Pho8 production when zinc is scarce, possibly as a mechanism to quickly restore activity when zinc becomes available again. This regulatory pattern differs from other yeasts where alkaline phosphatases are often targeted for degradation under low-zinc conditions as part of a zinc-sparing response .

How is Pho8 processing affected by cellular zinc status?

Research indicates that Pho8 is processed regardless of zinc status, and mature Pho8 accumulates under all zinc conditions. The protein undergoes normal post-translational modifications, including glycosylation and proteolytic processing, even in zinc-limited environments. This suggests that the processing machinery for Pho8 operates independently of zinc availability. The key difference appears to be in the activation of the processed enzyme rather than in its production or maturation .

What are the optimal conditions for measuring S. pombe Pho8 activity in vitro?

For optimal measurement of S. pombe Pho8 activity, alkaline phosphatase assays should be performed under zinc-replete conditions. Experimental evidence indicates that supplementing growth media with 100 μM zinc maximizes enzymatic activity. The assay should be conducted at alkaline pH, typically above pH 8, using appropriate phosphate-containing substrates. For quantitative analysis, spectrophotometric methods measuring product formation at specific wavelengths (often 405-412 nm, depending on the substrate) provide reliable activity measurements. Control experiments should include samples from pho8Δ strains to account for background phosphatase activity .

How should experimental designs be structured to study zinc-dependent regulation of Pho8?

When studying zinc-dependent regulation of Pho8, a factorial experimental design is most appropriate. This approach allows for the evaluation of multiple factors simultaneously, such as zinc concentration, time of exposure, and genetic background. Key experimental variables should include:

  • Zinc concentrations: Multiple concentrations ranging from 0 to 100 μM zinc

  • Time points: Measurements at different timepoints after zinc addition/depletion

  • Genetic variables: Wild-type, pho8Δ, and other relevant mutants

  • Protein synthesis inhibition: With/without cycloheximide to distinguish new synthesis vs. activation

A complete factorial design enables the assessment of both main effects and interaction effects, providing comprehensive insights into the regulatory mechanisms .

What techniques are most effective for detecting and quantifying Pho8 protein in S. pombe?

For effective detection and quantification of Pho8 protein in S. pombe, a combination of techniques yields the most comprehensive results:

  • Western blotting with specific anti-Pho8 antibodies provides qualitative assessment of protein levels and processing.

  • Enzyme activity assays using colorimetric substrates allow functional quantification.

  • Genetic approaches using tagged versions of Pho8 enable visualization of localization and trafficking.

For kinetic analysis of enzyme activity, spectrophotometric assays using substrate concentration gradients can generate Lineweaver-Burk plots to determine parameters like Km and Vmax under different conditions. This provides insights into both the amount of active enzyme and potential changes in its catalytic properties .

How can S. pombe Pho8 be engineered for use as a reporter in gene expression studies?

To engineer S. pombe Pho8 as a reporter in gene expression studies, several methodological approaches can be implemented:

  • Promoter fusions: Replace the native pho8 promoter with promoters of interest to study their regulation

  • Protein tagging: Add fluorescent or epitope tags to monitor localization and expression levels

  • Catalytic optimization: Introduce mutations to enhance activity or modify metal requirements

When designing such systems, ensure:

  • The expression system maintains proper protein processing

  • Zinc supplementation is controlled to avoid activity variations unrelated to the studied promoter

  • Background phosphatase activity is accounted for using appropriate controls (pho8Δ strains)

  • Assay conditions are standardized to allow for reliable quantitative comparisons between different constructs and conditions .

How can comparative studies between S. pombe Pho8 and alkaline phosphatases from other organisms provide evolutionary insights?

Comparative studies between S. pombe Pho8 and other alkaline phosphatases can reveal evolutionary adaptations in metal utilization and regulation. Research approaches should include:

  • Sequence alignment and phylogenetic analysis to identify conserved catalytic domains

  • Heterologous expression studies to examine functional conservation

  • Zinc-dependent regulation comparison across species to identify conserved or divergent regulatory mechanisms

These comparative studies can help determine whether the inverse relationship between expression and activity observed in S. pombe (higher expression but lower activity under zinc limitation) represents a unique adaptation or a conserved regulatory mechanism. This approach also provides insights into how different organisms have evolved strategies for metal homeostasis and phosphate metabolism .

What factors can affect the reproducibility of Pho8 activity assays in S. pombe?

Several factors can affect the reproducibility of Pho8 activity assays in S. pombe:

FactorPotential ImpactMitigation Strategy
Zinc contaminationFalse high activity readingsUse zinc-free glassware; include EDTA controls
Cell growth phaseVariation in expression levelsStandardize harvesting at specific growth phases
Media compositionBackground phosphate interferenceUse defined media with controlled phosphate levels
Cell disruption methodIncomplete enzyme extractionOptimize sonication/lysis protocols for consistency
Assay pHAltered enzyme kineticsMaintain strict pH control during reactions

To ensure reliable results, implement randomized block experimental designs where potential sources of variation (like batch effects) are controlled by testing all treatment conditions within each experimental block. This approach minimizes the impact of uncontrolled variables and increases statistical power to detect true treatment effects .

How should researchers address contradictory data regarding Pho8 activity and expression levels?

When confronting contradictory data about Pho8 activity and expression levels, researchers should implement a systematic analysis approach:

  • Separate measurement of transcript levels, protein abundance, and enzymatic activity

  • Time-course experiments to capture dynamic regulatory changes

  • Verification using multiple independent techniques for each measurement

  • Statistical analysis of variance (ANOVA) to identify significant factors and interactions

For example, if mRNA levels and protein levels don't correlate, investigate post-transcriptional regulation. If protein levels and enzyme activity don't correlate, examine post-translational modifications or cofactor availability. Analysis of variance techniques can help determine whether observed differences are statistically significant and identify interaction effects between experimental variables .

What statistical approaches are most appropriate for analyzing Pho8 activity data across different experimental conditions?

For robust statistical analysis of Pho8 activity data across different experimental conditions, the following approaches are recommended:

  • For comparing multiple treatments (e.g., different zinc concentrations):

    • Analysis of Variance (ANOVA) followed by post-hoc tests (e.g., Tukey's HSD)

    • Include randomized block designs to control for batch effects

  • For understanding relationships between variables:

    • Regression analysis to model relationships between zinc concentration and enzyme activity

    • Calculate the coefficient of determination (r²) to quantify how well the data fit the model

  • For time-course experiments:

    • Repeated measures ANOVA to account for correlation between time points

    • Mixed-effects models to handle missing data points

When reporting results, include both the effect size (e.g., fold-change in activity) and measures of statistical significance (p-values). For enzyme kinetic data, appropriate curve-fitting models (e.g., Michaelis-Menten, Lineweaver-Burk plots) should be used to determine parameters like Km and Vmax .

What are the potential applications of understanding zinc-dependent regulation of Pho8 in broader cellular contexts?

Understanding the zinc-dependent regulation of Pho8 has implications for several broader research areas:

  • Metal homeostasis mechanisms: Insights into how cells prioritize zinc utilization when this essential metal is limited

  • Stress response pathways: Understanding how cells adapt enzyme systems during nutrient limitation

  • Evolution of metalloenzyme regulation: Comparative studies across species can reveal conserved or divergent adaptation strategies

  • Biotechnological applications: Engineering zinc-responsive genetic circuits for synthetic biology applications

Researchers could explore how this regulatory system interacts with other cellular processes, such as phosphate homeostasis, vacuolar function, and general stress responses. This could lead to a more comprehensive understanding of how eukaryotic cells coordinate multiple regulatory systems to adapt to changing environmental conditions .

How might advanced genetic engineering approaches improve our ability to study Pho8 function and regulation?

Advanced genetic engineering approaches could significantly enhance Pho8 research through:

  • CRISPR/Cas9-mediated genome editing to:

    • Create precise mutations in metal-binding sites

    • Generate fluorescent protein fusions at endogenous loci

    • Implement inducible degradation systems to study Pho8 turnover kinetics

  • Synthetic biology approaches:

    • Design zinc-responsive genetic circuits using Pho8 regulatory elements

    • Create orthogonal systems to study Pho8 regulation isolated from native context

    • Engineer chimeric proteins combining domains from different phosphatases to study structure-function relationships

  • High-throughput screening methods:

    • Implement deep mutational scanning to comprehensively map functional domains

    • Develop reporter systems for monitoring zinc-dependent regulation in real-time

These approaches could provide unprecedented insights into the molecular mechanisms of zinc sensing, enzyme activation, and the functional significance of the inverse relationship between Pho8 expression and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.