Recombinant Schizosaccharomyces pombe Altered inheritance of mitochondria protein 19 homolog (aim19)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Aim19 is implicated in mitochondrial inheritance and quality control. Key findings include:

  • Evolutionary Conservation: Homologs of mitochondrial translation activators (e.g., Cbp3, Cbp6, Mss51) in S. pombe primarily function in post-translational assembly of respiratory complexes, contrasting with Saccharomyces cerevisiae, where they regulate translation .

  • Mitochondrial Gene Expression: S. pombe mitochondrial transcripts are processed via tRNA punctuation, resembling human mitochondrial RNA maturation .

  • Disease Modeling: Over 70% of S. pombe proteins have human orthologs, including those linked to mitochondrial disorders .

Comparative Table: Recombinant Aim19 Utility

ApplicationDetails
Mitochondrial DynamicsStudy mitochondrial transport, fission/fusion, and inheritance mechanisms .
OXPHOS Complex AssemblyInvestigate post-translational roles in respiratory chain complex III/IV assembly .
Gene Expression StudiesAnalyze tRNA punctuation-based processing of mitochondrial polycistronic transcripts .
Drug ScreeningTest compounds targeting mitochondrial dysfunction in cancer or neurodegenerative diseases .

Production and Quality Control

  • Expression Systems: While S. pombe itself is used for eukaryotic post-translational modifications , recombinant Aim19 is typically produced in E. coli for cost efficiency .

  • Yield: Typical yields range from 1.0–12.5 mg/L, depending on host system and induction conditions .

  • Validation: Purity confirmed via SDS-PAGE; functionality assessed through binding assays or genetic complementation .

Key Challenges and Future Directions

  • Functional Gaps: The precise molecular role of Aim19 in mitochondrial inheritance remains uncharacterized .

  • Structural Studies: No crystallographic or NMR data are available; structural analysis could clarify interaction partners.

  • Human Disease Models: Leverage S. pombe’s “petite-negative” phenotype (inviability without mitochondrial DNA) to study mtDNA-linked pathologies .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us beforehand, as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we advise adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own solutions.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag preference, please communicate it to us, and we will prioritize developing it accordingly.
Synonyms
aim19; SPBC17A3.02; Altered inheritance of mitochondria protein 19 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
aim19
Target Protein Sequence
MENKELRKSYFQRIYQSYIPAYAFGGALIASVPRAFKRPYGGPFVPGCLLCGGFNAIGGL AIASGDLTNGSGICTAWSIAYLMINATKSIKSFRLYPIALTTFATANAVGYGKTFMNEY
Uniprot No.

Target Background

Database Links
Protein Families
AIM19 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How is recombinant aim19 typically produced for research applications?

Recombinant aim19 protein is commonly produced using bacterial expression systems. The most frequently employed approach involves expressing the full-length protein (1-119 amino acids) in Escherichia coli with a histidine tag fusion for purification purposes. This method allows for efficient isolation of the protein via affinity chromatography .

The expression construct typically contains:

  • Full coding sequence (1-119 amino acids) of S. pombe aim19

  • N-terminal histidine tag for purification

  • Appropriate bacterial promoter and terminator sequences

After expression, the protein is purified to >90% homogeneity as verified by SDS-PAGE analysis, then lyophilized for storage and distribution .

What are the optimal storage and handling conditions for recombinant aim19?

For optimal stability and activity, recombinant aim19 protein should be stored according to these guidelines:

Storage ParameterRecommended Condition
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution methodDeionized sterile water to 0.1-1.0 mg/mL
Post-reconstitution additive5-50% glycerol (recommended final: 50%)

It is critical to avoid repeated freeze-thaw cycles as they can lead to protein degradation and loss of activity. Brief centrifugation prior to opening the vial is recommended to ensure all content is collected at the bottom of the tube .

How can S. pombe recombinant proteins be incorporated into mitochondrial inheritance studies?

When investigating mitochondrial inheritance using recombinant aim19, researchers should consider these methodological approaches:

  • In vitro binding assays: Using purified recombinant aim19 to identify interaction partners through co-immunoprecipitation, pull-down assays, or surface plasmon resonance.

  • Complementation studies: Introducing recombinant aim19 into aim19-deficient S. pombe strains to assess functional rescue, which can help determine structure-function relationships.

  • Localization studies: Combining fluorescently-tagged recombinant aim19 with mitochondrial markers to visualize subcellular localization and dynamics during cell division.

These approaches should be integrated with the established S. pombe experimental systems, which have been extensively developed to study various cellular processes including mitochondrial function .

What controls should be included when working with recombinant aim19 in experimental settings?

When designing experiments with recombinant aim19, the following controls are essential:

Control TypePurposeImplementation
Negative controlsRule out non-specific effectsHeat-denatured protein or irrelevant His-tagged protein
Concentration-dependent controlsEstablish dose-response relationshipsSerial dilutions of recombinant aim19
Buffer controlsAccount for buffer componentsSame buffer composition without protein
Strain controlsValidate genetic background effectsWild-type and aim19-knockout strains
Technical replicatesEnsure reproducibilityMinimum three independent experiments

The purity of the recombinant protein should be verified prior to experimental use, typically using SDS-PAGE analysis with a threshold of >90% purity .

How can researchers effectively validate the functional activity of recombinant aim19?

Functional validation of recombinant aim19 can be approached through multiple complementary methods:

  • In vivo complementation: Testing whether the recombinant protein can rescue phenotypic defects in aim19-deficient S. pombe strains.

  • Structural integrity verification: Using circular dichroism (CD) spectroscopy to confirm proper protein folding.

  • Mitochondrial segregation assays: Quantifying mitochondrial distribution during cell division in the presence versus absence of functional aim19.

  • Binding partner verification: Confirming known molecular interactions through co-immunoprecipitation or yeast two-hybrid assays.

These validation strategies help ensure that experimental observations reflect the true biological activity of aim19 rather than artifacts introduced during recombinant production or handling.

Why is Schizosaccharomyces pombe particularly valuable for studying mitochondrial inheritance proteins?

S. pombe offers several distinct advantages for studying mitochondrial inheritance proteins like aim19:

  • Evolutionary conservation: S. pombe shares significant conservation in chromosome structure and function genes with humans, making it an excellent model for studying conserved cellular processes .

  • Genetic tractability: As a haploid organism, S. pombe facilitates straightforward genetic manipulation and phenotypic analysis. The effects of mutations are immediately apparent without being masked by a second allele .

  • Well-characterized sexual reproduction: The mating and meiotic processes in S. pombe are extensively studied, allowing researchers to examine mitochondrial inheritance in the context of sexual reproduction .

  • Established assay systems: Numerous powerful in vivo genetic assays have been developed in fission yeast to study various cellular processes, which can be adapted to study mitochondrial inheritance .

  • Cellular architecture: The rod-shaped morphology of S. pombe cells makes it relatively straightforward to visualize and quantify mitochondrial distribution and inheritance patterns.

How do mating dynamics in S. pombe influence experimental approaches for mitochondrial inheritance studies?

The mating behavior of S. pombe has significant implications for experimental design when studying mitochondrial inheritance:

  • Variable mating efficiency: Natural isolates of S. pombe exhibit different mating efficiencies, ranging from 10% in some strains to 50% in others (like S. kambucha) . This variability must be accounted for when designing experiments involving sexual reproduction.

  • Density-dependent mating patterns: Cell density significantly affects mating behavior, with lower densities generally resulting in higher inbreeding coefficients . Researchers should standardize cell density in experiments to ensure consistent results.

  • Partner selection effects: The propensity for cells to mate with partners from the same or different clonal lineages varies between isolates and can be affected by available sexual partners . This variable should be controlled in experimental settings.

  • Fluorescent tagging approaches: Researchers can exploit fluorescent markers (GFP, mCherry) to track mating patterns and subsequent inheritance phenomena, as demonstrated in studies of meiotic drivers .

The inherent plasticity in S. pombe mating systems provides opportunities to examine mitochondrial inheritance across various mating scenarios but requires careful experimental control.

What methodological approaches are most effective for studying potential interactions between aim19 and meiotic drivers?

To investigate interactions between aim19 and meiotic drivers in S. pombe, researchers should consider these methodological approaches:

  • Genetic crossing experiments: Creating strains with fluorescently tagged aim19 and known meiotic drivers to track co-segregation patterns during meiosis.

  • Population genetics modeling: Employing mathematical models similar to those used in wtf driver studies to predict how aim19 variants might spread in populations with different mating patterns .

  • Cytological analysis: Using microscopy techniques to simultaneously visualize mitochondrial distribution and meiotic drive elements during sporulation.

  • Fitness assays: Quantifying the relative fitness of strains with different aim19 variants in the presence versus absence of meiotic drivers.

These approaches capitalize on the well-established experimental systems for studying meiotic drivers in S. pombe while extending them to investigate mitochondrial inheritance proteins.

How can researchers effectively study aim19 function in the context of DNA damage repair pathways?

Given S. pombe's established role in DNA damage repair research , investigating aim19 in this context requires:

  • Integration with established assays: Utilizing the numerous in vivo genetic assays developed for studying mitotic recombination in S. pombe to examine whether aim19 influences DNA damage response .

  • Double-strand break (DSB) repair analysis: Assessing whether aim19 mutations affect the efficiency or accuracy of DSB repair, particularly in relation to mitochondrial DNA maintenance.

  • Checkpoint response studies: Investigating whether aim19 plays a role in cell cycle checkpoint responses following DNA damage, especially as related to mitochondrial genome stability.

  • Recombination at repetitive elements: Using assays designed to study chromosomal recombination at non-tandem repeats to determine if aim19 influences recombination patterns, particularly in mitochondrial DNA .

This approach leverages S. pombe's powerful genetics and established methodologies for studying recombination while extending them to investigate mitochondrial inheritance proteins.

What experimental design considerations are critical when investigating aim19 variants across different S. pombe natural isolates?

When designing experiments to study aim19 across different S. pombe isolates, researchers should consider:

  • Genetic background effects: Different S. pombe isolates show significant phenotypic variation despite limited genetic diversity . Therefore, aim19 function should be studied in multiple genetic backgrounds.

  • Mating phenotype standardization: Given the natural variation in mating behaviors, studies should normalize for differences in mating efficiency and inbreeding propensity when comparing aim19 function across isolates .

  • Environmental condition variables: Environmental factors like cell density can affect mating patterns , potentially influencing mitochondrial inheritance. These variables should be systematically controlled or intentionally varied.

  • Evolutionary context: Considering the evolutionary relationships between different S. pombe isolates can provide context for understanding functional variations in aim19.

  • Comprehensive phenotypic analysis: Assessing multiple phenotypes related to mitochondrial function and inheritance, as different isolates may reveal distinct aspects of aim19 function.

By accounting for these variables, researchers can gain more robust insights into the biological roles of aim19 across the natural diversity of S. pombe.

How can studies of aim19 in S. pombe inform our understanding of mitochondrial inheritance in other organisms?

Research on aim19 in S. pombe can be extrapolated to other systems through:

  • Comparative genomics: Identifying and characterizing homologs of aim19 in other fungi, yeasts, and potentially higher eukaryotes.

  • Conserved mechanism identification: Determining which aspects of mitochondrial inheritance mediated by aim19 are evolutionarily conserved versus species-specific.

  • Heterologous expression studies: Expressing aim19 homologs from other species in S. pombe aim19-deficient strains to assess functional conservation.

  • Integration with mammalian cell models: Applying insights from S. pombe aim19 studies to investigate mitochondrial inheritance in mammalian systems, particularly focusing on conserved mechanisms.

S. pombe shares significant conservation with humans in many cellular processes , making it a valuable model for understanding conserved aspects of mitochondrial inheritance that may be relevant to human health and disease.

What technical challenges should researchers anticipate when studying aim19 and how can they be addressed?

Researchers working with aim19 should prepare for several technical challenges:

ChallengePotential Solution
Protein solubility issuesOptimize buffer conditions; consider fusion tags beyond His-tag
Functional redundancyGenerate multiple gene knockouts; employ synthetic genetic interaction screens
Mitochondrial visualizationUse specific mitochondrial dyes or fluorescent proteins targeted to mitochondria
Low expression levelsDevelop more sensitive detection methods; use overexpression systems judiciously
Post-translational modificationsImplement mass spectrometry to identify modifications; use phospho-specific antibodies

Additionally, researchers should consider the limitations of recombinant proteins produced in bacterial systems, which may lack eukaryotic post-translational modifications that could be essential for aim19 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.