Recombinant Schizosaccharomyces pombe Altered inheritance rate of mitochondria protein 38 homolog (aim38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
rcf2; aim38; SPAC1565.01; Respiratory supercomplex factor 2 homolog C1565.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
rcf2
Target Protein Sequence
MKLSTPEEVKAFNRNTYSALFKGALVGSSLGIAGWLIGNRYSAGFRRLPFSLKSWLVIGS GSGASIIFADKAGLKFEAERYGKFDQIDYSTKGLPWNQRALYYFNEHKWPIILGTWASTM GLSLYAASRNRYDTAPQKLIQARMYAQGVTVVVLLGSVYLSTLANRLEPLEREVLVTDPS NPTKLVAFKQRKERYPGELQWEVLVSQDEERLRKLNLPLREPHGSTGPMSTPTPALNSSR SA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit plays a role in the assembly of respiratory supercomplexes.
Database Links
Subcellular Location
Mitochondrion. Membrane; Multi-pass membrane protein.

Q&A

What is aim38 and what is its significance in mitochondrial research?

Aim38 (Altered inheritance rate of mitochondria protein 38 homolog) is a protein found in Schizosaccharomyces pombe that plays a role in mitochondrial function. It is also known as rcf2 (Respiratory supercomplex factor 2 homolog) in some literature . The significance of aim38 lies in its involvement in mitochondrial inheritance processes, which makes it valuable for studying mitochondrial dynamics and function.

S. pombe serves as an excellent model organism for mitochondrial research because it resembles human cells in terms of mitochondrial inheritance, transport, sugar metabolism, and mitogenome structure. Additionally, both S. pombe and human cells share the petite-negative phenotype, meaning their viability depends on the mitogenome . These similarities make aim38 research particularly relevant for understanding human mitochondrial processes and potential disease mechanisms.

How does S. pombe compare to other model organisms for mitochondrial research?

Schizosaccharomyces pombe has distinct advantages as a model organism for mitochondrial research compared to other commonly used models. Unlike some yeast models, S. pombe more closely resembles human cells in several key aspects of mitochondrial biology:

  • Mitochondrial inheritance patterns that parallel human cells

  • Similar mechanisms of mitochondrial transport

  • Comparable sugar metabolism pathways

  • Related mitogenome structure

  • Shared dependence on mitogenome for viability (petite-negative phenotype)

Furthermore, the mitochondrial gene expression machinery is structurally and functionally conserved between fission yeast and humans. The transcription of mitochondrial genomes in both organisms produces polycistronic transcripts that undergo processing according to the tRNA punctuation model . These similarities make S. pombe particularly valuable for biomedical research related to mitochondrial function and dysfunction.

What are the optimal storage and handling conditions for recombinant aim38 protein?

For optimal storage and handling of recombinant aim38 protein, researchers should follow these methodological guidelines:

  • Storage temperature: Store at -20°C for short-term or -80°C for extended storage to maintain protein stability and activity .

  • Aliquoting: To avoid repeated freeze-thaw cycles, which can degrade protein quality, aliquot the protein upon receipt .

  • Working aliquots: Store working aliquots at 4°C for up to one week to minimize degradation during experiments .

  • Buffer conditions: The protein is typically stored in Tris-based buffer with glycerol (for example, Tris/PBS-based buffer with 6% Trehalose, pH 8.0) .

  • Reconstitution: When using lyophilized protein, briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage .

Adhering to these handling procedures ensures the maintenance of protein integrity and experimental reproducibility.

How can researchers design experiments to study aim38 function in mitochondrial inheritance?

When designing experiments to study aim38 function in mitochondrial inheritance, researchers should consider a multi-layered approach:

  • Genetic manipulation strategies:

    • Gene knockout or knockdown to observe phenotypic effects on mitochondrial inheritance

    • Site-directed mutagenesis to identify functional domains

    • Complementation studies with human homologs to assess functional conservation

  • Fluorescence microscopy approaches:

    • Use fluorescently tagged strains (GFP or mCherry markers) to visualize mitochondrial dynamics and inheritance patterns

    • Time-lapse imaging to monitor mitochondrial distribution during cell division

    • Co-localization studies with other mitochondrial proteins

  • Mating assays:

    • Mix equal proportions of differently labeled cells (e.g., GFP-expressing and mCherry-expressing)

    • Plate on appropriate medium (such as SPA) that induces mating and meiosis

    • Image immediately after plating and again after 24-48 hours when cells have mated

    • Calculate inbreeding coefficients to quantify mating patterns

  • Biochemical analysis:

    • Protein-protein interaction studies to identify binding partners

    • Membrane potential assays to assess mitochondrial function

    • Respiration measurements to evaluate OXPHOS activity

These methodological approaches provide complementary data that together can elucidate the role of aim38 in mitochondrial inheritance and function.

What techniques are most effective for studying protein-protein interactions involving aim38?

To effectively study protein-protein interactions involving aim38, researchers should consider these methodological approaches:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitation (Co-IP)Identifying native protein complexesPreserves physiological conditionsMay miss transient interactions
Yeast two-hybrid (Y2H)Screening for potential interactorsHigh-throughput capabilityHigh false positive/negative rates
Bimolecular Fluorescence Complementation (BiFC)Visualizing interactions in vivoAllows spatial localizationMay force interactions artificially
Proximity Labeling (BioID/APEX)Identifying neighboring proteinsCaptures transient interactionsSpatial resolution limitations
Förster Resonance Energy Transfer (FRET)Measuring interaction dynamicsReal-time interaction analysisRequires fluorescent tagging
Cross-linking Mass SpectrometryMapping interaction interfacesProvides structural informationComplex data analysis

When implementing these techniques, researchers should consider using the full-length recombinant protein (amino acids 1-242) with appropriate tags such as His-tag . For co-immunoprecipitation experiments, using antibodies specific to aim38 or its interaction partners is crucial. The protein's storage buffer (Tris-based buffer with glycerol) should be taken into account when designing binding assays to maintain native conformation .

How does aim38 contribute to mitochondrial dynamics in S. pombe and what are the implications for human mitochondrial diseases?

Aim38 plays significant roles in mitochondrial dynamics in S. pombe that have relevant implications for human mitochondrial diseases. The protein, also known as rcf2, functions in respiratory chain complexes and impacts mitochondrial inheritance .

The conservation of mitochondrial gene expression machinery between S. pombe and humans makes aim38 research particularly valuable for understanding human mitochondrial diseases . Specifically:

  • Respiratory chain function: As a respiratory supercomplex factor homolog, aim38 likely influences the assembly or stability of respiratory chain complexes, which are frequent targets of mitochondrial disorders in humans.

  • Mitochondrial inheritance: Alterations in aim38 activity may impact how mitochondria are distributed during cell division, potentially affecting mitochondrial DNA segregation and inheritance patterns.

  • Mitochondrial gene expression: Since the machinery for mitochondrial gene expression is conserved between fission yeast and humans, disruptions in aim38 function may reveal mechanisms relevant to human diseases involving mitochondrial translation defects.

Studies in S. pombe provide an experimental platform that avoids some of the complexities of human systems while maintaining relevant biological similarities. The varying mating phenotypes observed in different S. pombe isolates also offer opportunities to study how genetic background influences mitochondrial inheritance mechanisms , potentially illuminating why certain mitochondrial diseases show variable penetrance in human populations.

What is the relationship between aim38 and meiotic drivers in S. pombe?

The relationship between aim38 and meiotic drivers in S. pombe represents an intriguing area of research that intersects mitochondrial function with genetic inheritance patterns. Meiotic drivers are genetic elements that break Mendel's law of segregation to be transmitted into more than half of the offspring produced by a heterozygote .

Research has shown that S. pombe harbors multiple meiotic drivers despite reportedly rare outcrossing in the wild. This presents an evolutionary paradox since drivers typically gain their advantage in heterozygotes, which requires outcrossing . The relationship with aim38 may involve:

  • Mating phenotype influence: The varying propensity for cells from distinct clonal lineages to mate in different S. pombe isolates may affect the spread of genetic elements like aim38 variants .

  • Cell density effects: Research has shown that cell density can affect mating behaviors in S. pombe, which may influence the inheritance patterns of mitochondrial proteins including aim38 .

  • Partner availability impacts: The available sexual partners can affect mating preferences, potentially creating selection pressures on mitochondrial inheritance factors .

  • Inbreeding coefficients: Studies measuring inbreeding coefficients (F) in S. pombe have found significant variation between natural isolates, which may affect the spread of aim38 variants with altered inheritance properties .

These factors suggest that aim38's role in altered inheritance of mitochondria could be influenced by, or itself influence, the success of meiotic drivers in S. pombe populations, creating a complex interplay between mitochondrial inheritance and meiotic drive systems.

How can temporally ordered data collection enhance research on aim38 expression patterns?

Temporally ordered data collection is crucial for understanding dynamic processes like aim38 expression and function in mitochondrial inheritance. Implementing temporal analysis methodologies can significantly enhance research quality and reliability in this field.

Temporally ordered tables are particularly useful for identifying patterns in aim38 expression over time or across different developmental stages . When designing such studies:

  • Temporal resolution considerations:

    • Sample at appropriate intervals to capture rapid changes in aim38 expression

    • Consider both short-term (minutes to hours) and long-term (days to generations) timeframes

    • Use synchronized cell populations when studying cell-cycle-dependent expression

  • Implementation methodology:

    • Design event listing tables that clearly establish temporal sequences of aim38 expression relative to other cellular events

    • Create temporally ordered tables to track empirical support for claimed temporal patterns in aim38 activity

    • Implement cross-case comparative tables when examining aim38 function across different S. pombe isolates

  • Data analysis approach:

    • Apply time-series analysis to identify patterns and periodicities in aim38 expression

    • Use visualization techniques that highlight temporal relationships

    • Employ statistical methods appropriate for time-dependent data

Temporal Analysis ElementApplication to aim38 ResearchContribution to Trustworthiness
Event listingTrack aim38 expression relative to cell cycle stagesEnsures precise establishment of temporal sequence of relevant events
Temporally ordered tableDocument changes in aim38 localization during mitochondrial inheritanceFacilitates systematic tracking of empirical support for claimed temporal patterns
Cross-case comparative tableCompare aim38 function across different S. pombe isolatesFacilitates systematic and thorough comparisons across cases
Co-occurrence tableTrack aim38 interactions with other proteins over timeFacilitates systematic tracking of co-occurrence patterns

This methodological approach helps establish causal relationships between aim38 activity and mitochondrial inheritance patterns, enhancing the reliability and reproducibility of research findings.

How should researchers interpret contradictory data regarding aim38 function?

When confronting contradictory data regarding aim38 function, researchers should employ a systematic approach to analysis and interpretation:

  • Methodological reconciliation:

    • Examine differences in experimental conditions (temperature, media, strain backgrounds)

    • Compare protein preparation methods (tags, expression systems, purification protocols)

    • Evaluate detection methods and their sensitivity/specificity

  • Biological context consideration:

    • Assess whether contradictions stem from different S. pombe isolates with varying genetic backgrounds

    • Consider mating type influences on aim38 function

    • Evaluate cell density effects that might alter experimental outcomes

  • Analytical framework:

    • Implement concept-evidence tables to systematically ground interpretations in empirical evidence

    • Use typologically ordered tables to compare different manifestations of aim38 function across the study database

    • Create theoretical summaries to help think through interpretations of contradictory findings

  • Triangulation approach:

    • Employ multiple experimental methods to test the same hypothesis

    • Use both in vivo and in vitro approaches to validate findings

    • Consider evolutionary conservation as a validation metric for functional hypotheses

When implementing this framework, researchers should remember that S. pombe shows significant variation in mating phenotypes between natural isolates , which could explain some apparent contradictions in aim38 function. Additionally, the dual naming of the protein (aim38/rcf2) in the literature may lead to seemingly contradictory reports that actually describe complementary aspects of its function .

What statistical approaches are most appropriate for analyzing aim38 experiments with small sample sizes?

When analyzing aim38 experiments with limited sample sizes, researchers should employ appropriate statistical approaches that maximize the value of available data while maintaining scientific rigor:

When reporting results from small sample experiments, researchers should be transparent about limitations, clearly state the number of biological and technical replicates, and avoid overinterpreting marginal findings. This approach enhances the credibility of aim38 research while maximizing the scientific value of limited sample studies.

How can researchers effectively compare aim38 function across different S. pombe isolates?

Effectively comparing aim38 function across different S. pombe isolates requires a structured methodological approach that accounts for genetic background variation and phenotypic differences:

  • Standardized experimental design:

    • Use identical culture conditions, media compositions, and growth parameters

    • Ensure protein expression and purification protocols are consistent

    • Implement synchronized cell cycle analyses to control for temporal variation

  • Comprehensive phenotypic profiling:

    • Assess mitochondrial morphology, distribution, and inheritance patterns

    • Measure respiratory capacity and OXPHOS function

    • Evaluate mating phenotypes that may influence aim38 function

  • Systematic comparative analysis:

    • Implement cross-case comparative tables to facilitate systematic comparisons

    • Use co-occurrence tables to track patterns of aim38 interaction partners across isolates

    • Develop typologically ordered tables to compare different manifestations of aim38 function

Analysis ApproachApplication to aim38 ResearchContribution to Comparative Analysis
Cross-case comparative tableCompare aim38 phenotypes across isolatesAllows for systematic display of evidence in support of cross-case variance claims
Co-occurrence tableTrack aim38 interaction partners across isolatesAllows for effective display of co-occurrence patterns across multiple cases
Typologically ordered tableCompare different manifestations of aim38 functionFacilitates systematic tracking of similarities and differences
Inbreeding coefficient analysisMeasure mating preferences that may affect aim38 inheritanceHelps assess context-dependent function of aim38
  • Genetic background consideration:

    • Account for the fractions of different ancestral S. pombe lineages present in each isolate

    • Consider transformation efficiency differences when introducing fluorescent markers

    • Evaluate mating efficiency variations, which range from 10% to over 50% depending on the isolate

Research has shown that different S. pombe isolates exhibit varying mating phenotypes that could influence mitochondrial inheritance patterns . This variation provides a natural experimental system for understanding how genetic background affects aim38 function in mitochondrial dynamics and inheritance.

What are common challenges when working with recombinant aim38 and how can they be addressed?

Researchers working with recombinant aim38 may encounter several challenges that can impact experimental outcomes. Here are the most common issues and methodological solutions:

  • Protein stability issues:

    • Challenge: Recombinant aim38 may degrade during storage or experimental procedures

    • Solution: Store at -20°C/-80°C upon receipt, make aliquots to avoid repeated freeze-thaw cycles, and maintain working aliquots at 4°C for up to one week only

    • Solution: Add 5-50% glycerol (final concentration) when reconstituting lyophilized protein

  • Solubility problems:

    • Challenge: Hydrophobic regions in aim38 may cause aggregation

    • Solution: Use appropriate buffer systems (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Solution: Reconstitute to appropriate concentrations (0.1-1.0 mg/mL) in deionized sterile water

  • Tag interference with protein function:

    • Challenge: Tags such as His may interfere with protein activity or interactions

    • Solution: Compare results using different tag positions (N-terminal vs. C-terminal) or tag types

    • Solution: Include tag-cleavage studies to confirm observed effects are not tag-dependent

  • Experimental variability:

    • Challenge: Inconsistent results across experiments

    • Solution: Implement data inventory tables to ensure all required data is collected

    • Solution: Use data analysis tables to track analytical steps leading to interpretations

    • Solution: Create concept-evidence tables to ground interpretations in empirical evidence

  • S. pombe strain variation effects:

    • Challenge: Different natural isolates show varying mating phenotypes

    • Solution: Consider testing aim38 function across multiple S. pombe isolates

    • Solution: Measure inbreeding coefficients when studying mating-dependent processes

By anticipating these challenges and implementing the suggested methodological solutions, researchers can enhance the reliability and reproducibility of their aim38 studies while minimizing experimental artifacts.

How can researchers validate the specificity of aim38 interactions in mitochondrial function studies?

Validating the specificity of aim38 interactions in mitochondrial function studies requires a multi-faceted approach to distinguish genuine biological interactions from experimental artifacts:

  • Control experiments:

    • Use tagged and untagged versions of aim38 to rule out tag-mediated interactions

    • Include non-related proteins of similar size/structure as negative controls

    • Perform competition assays with purified proteins to demonstrate specificity

  • Multiple interaction detection methods:

    • Cross-validate interactions using complementary techniques (e.g., co-IP, Y2H, FRET)

    • Mutate key residues in aim38 to identify interaction interfaces

    • Perform domain mapping to pinpoint specific interaction regions

  • Functional validation approaches:

    • Assess whether disrupting the interaction affects mitochondrial function

    • Use genetic approaches (knockout/knockdown) to confirm physiological relevance

    • Perform rescue experiments with wild-type aim38 to restore disrupted interactions

  • Evolutionary conservation assessment:

    • Compare interaction patterns with homologs in other species

    • Evaluate whether interaction interfaces are evolutionarily conserved

    • Test whether human homologs can functionally substitute for S. pombe aim38

  • Quantitative analysis:

    • Measure binding affinities to distinguish high-affinity from low-affinity interactions

    • Implement concept-evidence tables to systematically ground interaction claims in evidence

    • Use co-occurrence tables to track patterns of interaction across different experimental conditions

This comprehensive validation approach helps ensure that reported aim38 interactions represent biologically meaningful relationships rather than experimental artifacts, enhancing the reliability of mitochondrial function studies involving this protein.

What approach should researchers take when aim38 experimental results differ from published literature?

When aim38 experimental results differ from published literature, researchers should adopt a systematic approach to reconcile these differences and advance scientific understanding:

This approach not only helps resolve specific discrepancies but contributes to a more nuanced understanding of aim38 function. Differences in results often provide valuable insights into context-dependent protein functions that advance the field beyond simplified models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.