Recombinant Schizosaccharomyces pombe ATP-dependent zinc metalloprotease YME1 homolog (SPCC965.04c)

Shipped with Ice Packs
In Stock

Description

General Information

  • Gene Name: SPCC965.04c

  • Other Names: ATP-dependent zinc metalloprotease YME1 homolog EC= 3.4.24.-, mitochondrial inner membrane i-AAA protease complex subunit Yme1

  • Source Organism: Schizosaccharomyces pombe (Fission yeast)

  • Host Organism for Recombinant Production: E. coli, Yeast, Baculovirus, or Mammalian Cells, and Cell-Free Expression

  • Purity: Typically greater than 85% as determined by SDS-PAGE

Function and Characteristics

The YME1 homolog (SPCC965.04c) is a component of the i-AAA protease complex located in the inner mitochondrial membrane . YME1 proteins are ATP-dependent zinc metalloproteases . The S. pombe genome responds to zinc deficiency by altering the mRNA levels of a specific set of genes, indicating a role for zinc in the regulation of gene expression .

Role in Mitochondria

YME1 is associated with the mitochondrial inner membrane, oriented towards the matrix . Inactivation of YME1 in yeast leads to several distinct phenotypes: increased escape of DNA from mitochondria, temperature-sensitive growth on nonfermentable carbon sources, slow growth when mitochondrial DNA is absent, and altered mitochondrial morphology .

Zinc Dependence

Yme1p is a zinc-dependent protease . Zinc deficiency affects the expression of genes in S. pombe .

Expression and Complementation

Expressing Saccharomyces cerevisiae YME1 in Schizosaccharomyces pombe converts the latter to petite-positive, suggesting functional complementation .

Applications

Recombinant SPCC965.04c can be used in various applications, including:

  • ELISA

  • Western Blotting

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCC965.04c; ATP-dependent zinc metalloprotease YME1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-709
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC965.04c
Target Protein Sequence
MSRVLHPIFLFGKTSFLYSGCSKFGGRLFNNSIVHGWLRTRSYALASGLHPLRKQKLAHF EDLANANMSDPYMQAKLYKELADNFPEAIISRYETQGVARNSACDRYYQEALRKKSWSRS LSNNISLSQSSSSPATSSFSDPKAFSAGVPKFTSDTSSTVSSTPSLNHSLQNSMPPSTPT PPPVWAPTIVSSALGTSSKTPVYVVVDEPRFTKFFRIFKFIAGLSVASYFVLLGMSIFAE TSGLNNIMTNTTEQEPMEERAINVRFSDVQGVDEAKEELEEIVDFLRDPTHFTRLGGKLP RGVLLTGPPGTGKTMLARAVAGEANVPFFFMSGSQFDEMYVGVGAKRVRELFAAARKQAP SIIFIDELDAIGQKRNARDAAHMRQTLNQLLVDLDGFSKNEDLAHPVVFIGATNFPESLD PALTRPGRFDRHIHVPLPDVRGRLAILLQHTRHVPLGKDVDLSIIARGTSGFAGADLANL INQAAVYASKNLSTAVSMRDLEWSKDRILMGAERKSAFITPENKLMTAYHEGGHALVALF TKNAMRPYKATIMPRGSSLGMTISLPDMDKDSWTREEYLAMLDVTMGGRAAEELLYGKDK ITSGAHNDIDKATQVARRMVTEFGMSDRIGPVSLEAEMDNLSPATRALVESEIKSLLEAS YERSLSLLKSHKKELDALATALVDYEFLTAEEMNRVVKGDRDLLRNKLS
Uniprot No.

Target Background

Function
Putative ATP-dependent protease.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is SPCC965.04c and what is its functional significance in S. pombe?

SPCC965.04c is the gene encoding the S. pombe homolog of YME1, an ATP-dependent zinc metalloprotease that functions as a quality control protease in the inner mitochondrial membrane. As a member of the AAA+ (ATPases Associated with diverse cellular Activities) protein family, it plays a critical role in protein degradation within mitochondria. The protein forms a hexameric complex with a spiral staircase configuration of its ATPase domains, which facilitates substrate engagement and translocation toward the proteolytic chamber .

In S. pombe, this protein likely contributes to mitochondrial protein homeostasis, similar to its homologs in other organisms. S. pombe serves as an excellent model organism for studying such conserved cellular mechanisms due to its similarity to human systems in terms of gene structures, chromatin dynamics, and regulatory pathways .

How conserved is the YME1 protein from yeast to human systems?

The catalytic domains of the yeast YME1 share approximately 54% sequence identity with human homologs. This high conservation is functionally significant, as demonstrated by complementation studies showing that human Yme1l1 expression in yme-1-deficient yeast can restore mitochondrial function, indicating comparable activities and substrate profiles .

This conservation extends to the structural level, where the organization of AAA+ domains into a spiral staircase with progressively rotated and translated ATPases appears to be a conserved feature among AAA+ unfoldases, including those in the 26S proteasome .

What are the advantages of using S. pombe as a model organism for studying YME1?

S. pombe offers several distinct advantages as a model system for studying YME1 and related cellular processes:

  • As a unicellular "micromammal," S. pombe shares more common features with humans than S. cerevisiae does, including gene structures, chromatin dynamics, and intron prevalence .

  • It possesses RNAi pathways that are absent in S. cerevisiae but present in complex eukaryotes, making it more representative of higher eukaryotic systems .

  • The fission yeast system is relatively easy to maintain and manipulate genetically, allowing for versatile experimental approaches in genetics, genomics, and proteomics analyses .

  • Its centromeric organization and chromatin structure more closely resemble those of humans, with larger, more complex centromeres compared to S. cerevisiae .

What is the structural organization of the YME1 protein complex?

The YME1 protein assembles into a hexameric complex with a distinctive quaternary structure:

  • The AAA+ domains form a spiral staircase arrangement rather than a symmetric ring, with subunits progressively rotated and translated with respect to one another .

  • A "step" subunit connects the lowest and highest positions of the staircase, which is characteristic of closed-ring, type-I AAA ATPases .

  • The structure reveals three distinct nucleotide states coexisting within the hexamer: four subunits contain ATP, one has ADP, and one is in an "apo-like" state .

  • This asymmetric organization creates a translocation pathway for unfolded substrates, directing them toward the flat, symmetric protease ring for degradation .

Position in SpiralNucleotide StateStructural FeaturesFunction
Upper (ATP1-ATP4)ATP-boundWell-resolved ATP densitySubstrate engagement and processing
LowestADP-boundADP-like densityPost-hydrolysis state
StepApo-likeWeak nucleotide densityConnects highest and lowest positions

How do different nucleotide states affect the conformation and function of YME1?

The ~3.4 Å cryo-EM structure of YME1 reveals how three coexisting nucleotide states (ATP, ADP, and apo-like) within the hexamer allosterically induce distinct positioning of key residues, particularly tyrosines, in the central channel . These conformational changes are essential for:

  • Sequential substrate engagement and translocation through the central pore

  • Coordination of ATP hydrolysis in an around-the-ring cycle

  • Directing the unfolded substrate toward the negatively charged proteolytic chamber

The nucleotide-driven motions of the ATPase spiral are accommodated by a hinge-like linker that allows independent movement relative to the planar proteolytic base . This structural flexibility is likely critical for the protein's function in substrate processing.

What methodological approaches are most effective for studying SPCC965.04c-mediated protein degradation in vivo?

For studying SPCC965.04c-mediated protein degradation in vivo, researchers should consider a multi-faceted approach:

  • Genetic manipulation in S. pombe: Leverage the genetic tractability of fission yeast to create knockout, knockdown, or conditional expression strains. S. pombe cells can be cultured in rich medium (YES) liquid culture at 30°C until mid-log phase before harvesting for experiments .

  • Immunoprecipitation studies: Perform co-immunoprecipitation experiments to identify interaction partners and potential substrates. This can be combined with mass spectrometry for comprehensive protein identification .

  • Functional complementation assays: Test whether human YME1L1 can complement SPCC965.04c deficiency in S. pombe, similar to experiments showing functional conservation between yeast and human homologs .

  • Microscopy and cellular localization: Use fluorescence microscopy techniques to visualize protein localization and potential colocalization with mitochondrial markers, taking advantage of S. pombe's well-defined cellular architecture .

  • Meiotic analysis: For studying protein function during different cellular states, induce S. pombe to enter the meiotic cycle and analyze protein activity during this alternative cellular program .

How can researchers optimize expression and purification of recombinant SPCC965.04c for structural and functional studies?

For optimal expression and purification of recombinant SPCC965.04c:

  • Expression system selection: E. coli expression systems have proven effective for producing the recombinant protein with a His-tag, as indicated by commercial availability of His-tagged full-length protein (spanning amino acids 1-709) .

  • Construct design considerations:

    • Include appropriate affinity tags (His-tag has been successfully used)

    • Consider removing transmembrane domains for improved solubility

    • Engineer constructs that maintain the integrity of functional domains

  • Purification strategy: Implement a multi-step purification protocol that might include:

    • Initial affinity chromatography using the His-tag

    • Size exclusion chromatography to isolate properly assembled hexameric complexes

    • Ion exchange chromatography for additional purity

  • Stability considerations: Include appropriate cofactors during purification, such as ATP or non-hydrolyzable analogs, to stabilize the hexameric assembly and prevent aggregation.

What strategies can be employed to identify the substrate specificity of SPCC965.04c?

To elucidate substrate specificity of SPCC965.04c, researchers should consider:

  • Comparative proteomics: Compare protein abundance profiles between wild-type and SPCC965.04c-deficient S. pombe strains to identify proteins that accumulate in the absence of this protease.

  • Structure-guided mutagenesis: Based on the spiral staircase structure of YME1, design mutations in key residues of the substrate-binding channel and analyze how these affect recognition and processing of different proteins .

  • Cross-species substrate analysis: Compare substrates of YME1 homologs from different species, given the functional conservation observed between yeast and human systems .

  • In vitro degradation assays: Develop reconstituted systems with purified components to directly test candidate substrates and define sequence or structural features that determine recognition.

How can researchers distinguish between direct and indirect effects when studying SPCC965.04c function?

To differentiate direct from indirect effects of SPCC965.04c function:

  • Use catalytically inactive mutants: Generate protease-dead or ATPase-dead variants based on the known structure. These would maintain protein-protein interactions but lack catalytic activity .

  • Acute depletion systems: Implement rapid depletion strategies to observe immediate effects before compensatory mechanisms engage.

  • Direct binding assays: Utilize techniques such as surface plasmon resonance or microscale thermophoresis to quantify direct interactions with candidate substrates.

  • Time-course experiments: Perform temporal analyses following SPCC965.04c inactivation to distinguish primary from secondary effects.

  • In vitro reconstitution: Establish defined systems with purified components to directly test protein interactions and enzymatic activities.

What controls are essential when examining the structural organization of recombinant SPCC965.04c?

Essential controls when studying SPCC965.04c structure include:

  • Nucleotide state controls: Compare structures in the presence of different nucleotides (ATP, ADP, non-hydrolyzable analogs) to capture different conformational states, as the protein exhibits three distinct nucleotide states (ATP, ADP, and apo-like) within its hexameric assembly .

  • Mutant controls: Analyze variants with mutations in key functional residues, particularly those involved in nucleotide binding or hydrolysis.

  • Cross-species comparisons: Compare with structures of homologs from other organisms, such as human YME1L1, to identify conserved and divergent features .

  • Resolution validation: For structural studies, implement appropriate validation metrics to ensure the reliability of structural details, particularly at interfaces between subunits in the spiral staircase arrangement .

How should researchers interpret discrepancies between in vitro and in vivo studies of SPCC965.04c?

When interpreting discrepancies between in vitro and in vivo findings:

  • Consider cellular context: The RNAi pathways and epigenetic regulation present in S. pombe but absent in in vitro systems may influence protein function .

  • Evaluate protein interactions: The interaction network in vivo may include regulatory partners absent in reconstituted systems.

  • Assess post-translational modifications: PTMs that occur in vivo might be missing in recombinant proteins, potentially affecting activity or specificity.

  • Membrane environment effects: The natural membrane environment of this inner mitochondrial membrane protein likely influences its conformation and activity in ways difficult to replicate in vitro .

  • Compensatory mechanisms: Redundant proteases or stress response pathways may mask phenotypes in vivo that would be apparent in isolated systems.

How does SPCC965.04c compare to its homologs in other model organisms?

The comparative analysis of YME1 homologs reveals important insights into evolutionary conservation and specialization:

SpeciesProteinSequence Identity to S. pombe YME1Key Features
S. pombeSPCC965.04c100%ATP-dependent zinc metalloprotease, 709 amino acids
S. cerevisiaeYME1~60% (estimated)Inner mitochondrial membrane AAA+ protease
H. sapiensYME1L154% (catalytic domains) Can functionally complement yeast YME1 deficiency

Key differences include:

  • Structural organization: While the general spiral staircase arrangement appears conserved, species-specific variations likely exist in substrate recognition regions .

  • Regulatory mechanisms: Different organisms may employ distinct mechanisms to control YME1 activity, reflecting adaptation to specific cellular environments.

  • S. pombe's closer resemblance to human systems: The fission yeast shares more features with humans than S. cerevisiae does, including gene structure, chromatin dynamics, and regulatory pathways .

What insights can be gained from studying the evolutionary conservation of YME1 structure and function?

Studying the evolutionary conservation of YME1 provides valuable insights:

  • Core mechanism conservation: The spiral staircase arrangement of AAA+ domains and the sequential ATP hydrolysis mechanism appear to be fundamental to function and conserved across species .

  • Adaptation to cellular environments: Species-specific variations likely reflect adaptations to different mitochondrial proteostasis needs.

  • Substrate evolution: Changes in substrate specificity across species may reveal how protein quality control systems co-evolved with their targets.

  • Human disease relevance: The high conservation between S. pombe and human YME1 (54% identity in catalytic domains) makes findings potentially translatable to understanding human mitochondrial disorders .

What emerging technologies could advance our understanding of SPCC965.04c function?

Emerging technologies that could enhance SPCC965.04c research include:

  • Cryo-electron tomography: This could reveal the in situ organization of YME1 complexes within the native mitochondrial membrane environment.

  • Single-molecule techniques: Methods like FRET or optical tweezers could provide direct visualization of substrate processing and the dynamics of conformational changes during the ATP hydrolysis cycle.

  • Genome-wide CRISPR screens in S. pombe: Systematic genetic interaction mapping could identify functional networks and regulatory pathways for YME1.

  • Integrative structural biology: Combining multiple structural techniques (cryo-EM, crosslinking-mass spectrometry, computational modeling) could provide more comprehensive models of YME1-substrate interactions.

  • Advanced imaging techniques: Super-resolution microscopy and correlative light-electron microscopy could offer new insights into YME1 localization and dynamics within mitochondria.

How might findings from SPCC965.04c research translate to understanding human mitochondrial diseases?

Research on SPCC965.04c has significant translational potential:

  • The high sequence conservation (54% identity in catalytic domains) between S. pombe YME1 and human homologs suggests mechanistic insights may be directly applicable to human biology .

  • The ability of human Yme1l1 to restore function in yeast lacking YME1 indicates functional conservation that makes S. pombe a valuable model for human disease mechanisms .

  • S. pombe's "micromammal" characteristics, including its chromatin organization and RNAi pathways that are absent in S. cerevisiae but present in humans, enhance its relevance as a model for mitochondrial protein quality control .

  • Understanding the fundamental mechanisms of YME1 function could inform therapeutic strategies targeting mitochondrial protein homeostasis in human diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.