Recombinant Schizosaccharomyces pombe Autophagy-related protein 9 (atg9)

Shipped with Ice Packs
In Stock

Description

Comparative Analysis with Homologs

Atg9 is highly conserved across eukaryotes, with functionally similar proteins found in multiple species. The table below summarizes key homologs across different organisms:

SpeciesProtein NameGene Name(s)FunctionHomolog in Humans
S. pombeAutophagy-related protein 9atg9/apg9Lipid scramblaseATG9A/B
S. cerevisiaeAutophagy-related protein 9ATG9Membrane transportATG9A/B
Homo sapiensAutophagy-related protein 9A/BATG9A/ATG9BMembrane transport-

This evolutionary conservation underscores the fundamental importance of atg9 in autophagy mechanisms across diverse eukaryotic species .

Functional Role in Autophagy

S. pombe atg9 serves as an essential component of the core autophagy machinery, playing multiple crucial roles in the formation and maturation of autophagosomes.

Membrane Transport and Phagophore Formation

As the sole integral membrane protein absolutely required for autophagosome formation, atg9 plays a critical role in membrane transport to the phagophore assembly site (PAS) . The protein is thought to contribute to the delivery of membrane components necessary for phagophore expansion, serving as a "carrier" of lipids to the developing autophagosome .

Notably, atg9 is absent from completed autophagosomes, suggesting that the protein is retrieved upon vesicle completion . This dynamic localization pattern is consistent with its proposed role in the early stages of autophagosome formation rather than as a structural component of the mature autophagosome.

Lipid Scramblase Activity

Recent research has identified S. pombe atg9 as a lipid scramblase, facilitating the bidirectional movement of lipids across membrane bilayers . This activity is crucial for membrane remodeling during autophagosome biogenesis, as it affects membrane curvature and fluidity - essential properties for phagophore initiation and expansion.

Self-Interaction Mechanisms

A remarkable feature of atg9 is its ability to self-interact independently of other autophagy proteins under both nutrient-rich and starvation conditions . This self-association, which is mediated primarily through the C-terminus of the protein, promotes the trafficking of atg9 from peripheral sites to the PAS and is required for both selective and non-selective autophagy at the step of phagophore expansion .

The self-interaction property has profound functional implications, as mutations that disrupt this ability severely impair autophagy. Research suggests that atg9 multimerization facilitates membrane flow to the PAS for phagophore formation, potentially explaining how small membrane fragments are incorporated into the expanding phagophore .

Production and Characterization of Recombinant S. pombe atg9

The production of recombinant S. pombe atg9 involves sophisticated biotechnological approaches to ensure the generation of functional protein for research applications.

Expression Systems

Recombinant S. pombe atg9 can be produced using various expression systems, each with distinct advantages:

  1. E. coli Expression: Provides high yield and cost-effectiveness, suitable for producing protein fragments for structural studies or antibody production .

  2. Yeast Expression: Offers a eukaryotic environment with appropriate post-translational modifications, beneficial for functional studies .

  3. Baculovirus Expression: Enables high expression levels of properly folded complex proteins, useful for structural and functional analyses .

  4. Mammalian Cell Expression: Ensures proper folding and post-translational modifications, ideal for functional studies requiring native-like protein characteristics .

  5. Cell-Free Expression: Allows for rapid protein synthesis without cellular constraints, particularly valuable for membrane proteins like atg9 .

Purification and Quality Control

Standard purification protocols for recombinant S. pombe atg9 typically achieve ≥85% purity as determined by SDS-PAGE . The purification process generally involves affinity chromatography, taking advantage of fusion tags incorporated during recombinant expression.

For optimal stability, purified recombinant atg9 is recommended to be stored in Tris-based buffer with 50% glycerol at -20°C for regular use, with long-term storage at -80°C to maintain protein integrity . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

Research Applications and Findings

Recombinant S. pombe atg9 has emerged as a valuable tool in autophagy research, contributing to our understanding of fundamental mechanisms and regulatory pathways.

The Atg9-Centered Interactome

Recent research has revealed that atg9 functions within a complex network of protein interactions that regulate its localization, activity, and role in autophagosome formation. An Atg9-centered multi-omics approach identified numerous proteins that interact with atg9 during autophagy .

Interestingly, while atg9 interacts with hundreds of proteins, most known atg9-interacting autophagy regulators do not show significant changes at the mRNA or protein level during autophagy, suggesting complex regulatory mechanisms beyond simple expression changes . This observation led to the development of a computational method called inference of functional interacting partners (iFIP), which integrates transcriptomic, proteomic, and interactomic data to identify new potential autophagy regulators .

Newly Identified Interaction Partners

The iFIP method predicted 42 Atg9-interacting proteins potentially involved in autophagy, including 15 known Atg proteins or autophagy regulators . Among the newly identified candidates, two proteins - Glo3 and Scs7 - were experimentally validated to play roles in both bulk and selective autophagy .

Further investigation revealed that:

  • The mRNA and protein expression levels of Glo3 and Scs7 (but not their subcellular localizations) were affected by the presence or absence of atg9 during autophagy

  • These proteins partially colocalized with atg9, with enhanced colocalization observed during early stages of autophagy

  • Glo3 specifically regulates the retrograde transport of atg9 during autophagy, while Scs7 functions through different mechanisms

These findings highlight the value of recombinant atg9 in identifying and characterizing new components of the autophagy machinery.

Role in the Core Autophagy Machinery

Within the broader context of autophagy, S. pombe atg9 functions as part of a coordinated system of proteins that orchestrate autophagosome biogenesis. In fission yeast, the core Atg proteins responsible for this process can be classified into six functional groups, as outlined in the table below:

Functional GroupComponentsFunction
Atg1 complexAtg1, Atg11, Atg17, Atg13, Atg101Initiation of autophagy
Integral membrane proteinsAtg9, Ctl1Membrane transport and remodeling
PtdIns3K complex IVarious componentsPhospholipid modification
Atg18 family and Atg2Atg18, Atg2Membrane expansion
Atg12 conjugation systemMultiple componentsProtein modification
Atg8 conjugation systemMultiple componentsProtein-lipid conjugation

Atg9 and Ctl1 (which promotes proper localization of Atg9) form a distinct functional group within this machinery . The integral membrane nature of atg9 distinguishes it from most other Atg proteins, which are predominantly cytosolic or peripherally associated with membranes. This unique characteristic positions atg9 at the interface between membrane dynamics and the core autophagy machinery.

Evolutionary Conservation and Species-Specific Adaptations

The fundamental role of atg9 in autophagy is reflected in its evolutionary conservation across eukaryotes. Comparative analysis between S. pombe, S. cerevisiae, and human homologs reveals preservation of key functional domains, particularly those involved in membrane integration and protein interactions.

Despite this conservation, species-specific adaptations in atg9 structure and function have been observed. These differences may reflect adaptations to specific cellular environments, metabolic requirements, or autophagy-related processes unique to each organism. For example, while the core membrane-spanning regions show high conservation, the cytoplasmic N- and C-terminal domains exhibit greater variation, suggesting divergent regulatory mechanisms or interaction partners across species.

Future Research Directions

Despite significant advances in understanding S. pombe atg9, several important questions remain unanswered, presenting opportunities for future research:

  1. Structural Determination: Resolving the high-resolution structure of full-length S. pombe atg9, particularly regarding the arrangement of its transmembrane domains, remains a significant challenge.

  2. Dynamic Interactome Mapping: Comprehensive characterization of the dynamic interactome of atg9 during different stages of autophagy would provide insights into the temporal regulation of autophagosome formation.

  3. Mechanistic Understanding: Further investigation into how atg9 contributes to membrane curvature and phagophore expansion at the molecular level is needed.

  4. Regulatory Mechanisms: Elucidating the precise mechanisms controlling atg9 trafficking and activity in response to various cellular stresses would enhance our understanding of autophagy regulation.

Emerging technologies in structural biology, particularly advances in cryo-electron microscopy and tomography, offer promising approaches for addressing these knowledge gaps. Additionally, computational approaches integrating multi-omics data, as exemplified by the iFIP method, represent valuable strategies for identifying new functional partners and regulatory mechanisms of atg9.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atg9; apg9; SPBC15D4.07c; Autophagy-related protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
atg9
Target Protein Sequence
MFYQPAQNKKQYDDLADIEAQNNVPNTQEVLEAWQESLDSDEDESSPLEESNGFTISEHD DFVKSVPRKNNPTDLLYSGKLLDSDEPPSVHGNSSKVPSKHPSPSFPETTSLRNLQNGSK QKPALPNFNDPHFYNEDVTRSGHPNRSIYTQLPRNEFSNARVLWNRLSARDRVLWRWANV ENLDSFLQQVYTYYTGKGLSCIIVHRLFQILTVSFVIGFTTFITSCIDWPAVTPHGSLAG VTKSQCIAQMSPITYLVLWLFLSFLLALWIYYLTDIPRLWQMREFYIHALKIATADMPTV SWQRVLYRLLKLKNVNALTAEDGRVVSLHNMKRLDAYAIANRIMRKDNYFIALINNGIIN IELPLLHRRILTHTTEWNINWCIFNFVFDEQGQLRSAFRNPNSRKRLSEELRRRFIVAGF LNCLFAPIVAIYLVIHNFFRYFNEYHKNPGALSTRRYTPLALWTFREYNELQHFFDERIN DSYAAASHYVSQFPDFNMIRLFKYISFILGSFTAILVIITVFDPELMVTFEITKDRSVLF YLGLFGSLIAVSRSIIPDETLVFAPEKALRRVITFTHYMPGWWSDNMHSKAVQQEFCSLY SYRIVNLLWEILGILLTPVLLFFTFPSCSQDIVDFFREHTINVEGVGYVCSYAVFQDNPP YESVASLVQSRKISPLIQNKPELSRISFYEQFNTEAPRRDLR
Uniprot No.

Target Background

Function
Recombinant *Schizosaccharomyces pombe* Autophagy-related protein 9 (Atg9) is a phospholipid scramblase crucial for autophagy and cytoplasm-to-vacuole transport (Cvt) vesicle formation. It cycles between the pre-autophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool, providing membrane for growing autophagosomes. Its lipid scramblase activity is key in pre-autophagosomal structure/phagophore assembly, distributing phospholipids (delivered via Atg2 from the cytoplasm) to the luminal leaflet of the bilayer, thus driving autophagosomal membrane expansion. Atg9 is also involved in ER-specific autophagy and is essential for cell survival under severe ER stress. Distinct mechanisms govern its anterograde trafficking to the PAS during Cvt or bulk autophagy and its retrograde trafficking. It also plays a role in meiosis and sporulation.
Database Links
Protein Families
ATG9 family
Subcellular Location
Preautophagosomal structure membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Autophagy-related protein 9 (atg9) in S. pombe and what are its key characteristics?

Autophagy-related protein 9 (atg9) in Schizosaccharomyces pombe is a critical component of the core autophagy machinery. It is encoded by the gene SPBC15D4.07c, also known as apg9, and is identified by UniProt accession number O74312. The protein is integral to autophagy processes in fission yeast and serves as a transmembrane protein involved in the formation of autophagosomal membranes. Atg9 contains multiple transmembrane domains and contributes to autophagosome precursor formation through its vesicular trafficking properties. The protein belongs to the organism-gene category according to the Protein Ontology (PRO) classification and is specifically defined as "a protein that is a translation product of the atg9 gene in Schizosaccharomyces pombe 972h-" .

What post-translational modifications occur on S. pombe atg9?

S. pombe atg9 undergoes multiple post-translational modifications that likely regulate its function and activity. Based on proteomic studies, atg9 in S. pombe has been identified with numerous phosphorylation sites and one N-glycosylation site:

SitePTM TypeSourcePMIDs
Y3PhosphorylationPomBase30726745
S78PhosphorylationPomBase21712547, 33823663, 34296454, 24763107, 30726745
S89PhosphorylationPomBase24763107
N93N-GlycosylationPomBase22633491
S99PhosphorylationPomBase30726745, 21712547, 25720772
S103PhosphorylationPomBase24763107, 21712547, 25720772, 30726745
T110PhosphorylationPomBase30726745
S111PhosphorylationPomBase30726745
S147PhosphorylationPomBase34296454
S327PhosphorylationPomBase21712547

These modifications, particularly the extensive phosphorylation pattern, suggest complex regulatory mechanisms that control atg9 function during autophagy .

What expression systems are optimal for recombinant S. pombe atg9 production?

For recombinant S. pombe atg9 production, several expression systems can be employed depending on experimental requirements. The choice should consider protein size, transmembrane domains, and post-translational modifications:

  • Homologous expression in S. pombe: Offers native post-translational modifications and proper folding. Recommended vectors include pREP series with thiamine-repressible promoters or pJK148 for chromosomal integration.

  • E. coli expression systems: For expressing soluble domains of atg9, but not ideal for full-length protein due to transmembrane regions. Consider fusion tags such as MBP, SUMO, or TrxA to enhance solubility.

  • Insect cell/baculovirus system: Appropriate for full-length atg9 with proper folding and post-translational modifications. This system has been successfully used for membrane proteins related to autophagy.

  • Mammalian cell expression: For studies requiring mammalian-type glycosylation patterns, particularly important when studying the N93 glycosylation site.

When expressing full-length atg9, it's critical to include proper detergents during purification to maintain protein stability and function, as the transmembrane domains make this a challenging protein to work with in recombinant systems.

How can I monitor the trafficking of atg9 in S. pombe cells?

Monitoring atg9 trafficking in S. pombe requires specialized techniques to visualize this dynamic process:

  • Fluorescent protein tagging: Express atg9 fused to fluorescent proteins (GFP, YFP, mCherry) under native promoter control. This approach allows live-cell imaging of atg9 vesicles. When designing fusion constructs, consider that C-terminal tags are generally preferred as they minimize interference with membrane insertion.

  • Time-lapse microscopy: Implement time-lapse confocal microscopy to track atg9-positive vesicles in real-time during autophagy induction. This can be triggered by nitrogen starvation, which is a standard method to induce autophagy in yeast systems.

  • Colocalization studies: Use markers for different cellular compartments (endosomes, Golgi, pre-autophagosomal structure) to track atg9 movement between organelles. This can be achieved by co-expressing differently colored fluorescent proteins tagged to relevant compartment markers.

  • Immunogold electron microscopy: For higher resolution analysis, immunogold labeling of atg9 coupled with electron microscopy provides detailed ultrastructural localization.

  • Photoactivatable or photoconvertible tags: These advanced tags allow pulse-chase experiments to track specific populations of atg9 vesicles over time.

These approaches have revealed that atg9 cycles between peripheral structures and the pre-autophagosomal site, with its trafficking significantly altered during autophagy induction.

How does atg9 interact with other autophagy proteins in the S. pombe system?

In S. pombe, atg9 functions within a complex network of protein interactions that regulate autophagy. While specific S. pombe data is limited in the search results, comparative studies with other yeast species provide valuable insights:

  • Interaction with Atg1 kinase complex: In S. pombe, the Atg1 kinase complex is critical for autophagy, and its activity requires Atg11 (ortholog of mammalian FIP200/RB1CC1). Though not directly stated for S. pombe in the search results, by homology with other systems, atg9 likely interacts with components of this complex during autophagy initiation .

  • Recruitment of downstream factors: By extrapolation from S. cerevisiae studies, S. pombe atg9 likely first binds to autophagy components at the pre-autophagosomal structure (PAS), then recruits additional factors such as Atg2 and Atg18 homologs .

  • Dynamic interaction network: During autophagy, atg9 interactions likely change temporally, with different binding partners predominating at different stages of the process. Evidence from S. cerevisiae suggests that atg9 vesicles act as seeds to establish membrane contact sites for recruitment of downstream autophagy proteins .

  • Regulatory interactions: The extensive phosphorylation pattern of atg9 suggests regulation by multiple kinases, indicating intricate control mechanisms governing its function during autophagy .

To comprehensively map the S. pombe atg9 interactome, techniques such as proximity labeling (BioID or APEX), co-immunoprecipitation coupled with mass spectrometry, and yeast two-hybrid screening can be employed.

What methods are most effective for identifying novel atg9 interaction partners in S. pombe?

Identifying novel atg9 interaction partners in S. pombe requires targeted approaches that overcome challenges associated with membrane proteins:

  • Affinity purification-mass spectrometry (AP-MS): Express epitope-tagged atg9 (such as TAP, FLAG, or HA tags) in S. pombe and perform immunoprecipitation followed by mass spectrometry analysis. For membrane proteins like atg9, mild detergents (such as digitonin, DDM, or CHAPS) should be used to maintain native interactions.

  • Proximity-dependent labeling: Methods such as BioID or APEX2 fusion to atg9 allow biotinylation of proteins in close proximity to atg9 in living cells. This is particularly valuable for capturing transient interactions that may be lost during traditional immunoprecipitation.

  • Split-fluorescent/luminescent protein complementation: Techniques like BiFC (Bimolecular Fluorescence Complementation) can visualize interactions in vivo by fusing potential interacting pairs with complementary fragments of a fluorescent protein.

  • Integrated multi-omics approaches: Similar to the iFIP (inference of functional interacting partners) method developed for S. cerevisiae, integrating transcriptomic, proteomic, and interactomic data can predict functional atg9 interaction partners in S. pombe .

  • Comparative genomics approach: Leverage known atg9 interactions from other yeast species to identify and validate conserved interactions in S. pombe.

For validation of identified interactions, techniques such as co-immunoprecipitation, FRET analysis, and functional assays (e.g., testing autophagy phenotypes in deletion mutants) should be employed.

What are the most reliable methods for assessing autophagy defects in S. pombe atg9 mutants?

Several robust methods can be employed to assess autophagy defects in S. pombe atg9 mutants:

  • GFP-Atg8 processing assay: Express a GFP-Atg8 fusion protein in wild-type and atg9 mutant strains. During autophagy, GFP-Atg8 is delivered to the vacuole where Atg8 is degraded while GFP remains relatively stable. Western blotting to detect the ratio of free GFP to GFP-Atg8 provides a quantitative measure of autophagy flux .

  • Fluorescence microscopy of fluorescent protein-tagged Atg8: Track the localization of YFP-Atg8 or GFP-Atg8 to monitor autophagosome formation and vacuolar delivery. In functioning autophagy, Atg8 appears as puncta that eventually localize to the vacuole. In atg9 mutants with defective autophagy, this pattern will be altered .

  • Pho8Δ60 assay: This biochemical assay uses an engineered form of alkaline phosphatase (Pho8Δ60) that is only activated when delivered to the vacuole via autophagy. The assay has been adapted for use in S. pombe and provides a quantitative measurement of bulk autophagy .

  • Electron microscopy: Ultrastructural analysis can directly visualize autophagosomes and autophagic bodies in the vacuole, allowing assessment of autophagosome formation defects in atg9 mutants.

  • Selective autophagy assays: Besides bulk autophagy, specific cargo degradation assays (such as mitophagy or pexophagy markers) can reveal defects in selective forms of autophagy.

When comparing wild-type and atg9 mutant strains, it's essential to examine autophagy under both nutrient-rich and nitrogen-starved conditions, as starvation is a potent inducer of autophagy in yeast systems .

How do phosphorylation site mutations impact S. pombe atg9 function?

Phosphorylation site mutations in S. pombe atg9 can significantly impact its function through several mechanisms:

  • Regulation of trafficking: Phosphorylation likely regulates atg9 vesicle trafficking between different cellular compartments. Mutation of key phosphorylation sites (such as S78, S99, and S103, which appear to be heavily phosphorylated based on multiple studies) may disrupt this dynamic movement .

  • Protein-protein interactions: Phosphorylation often creates or eliminates binding sites for interacting proteins. Mutating these sites can disrupt the formation of functional protein complexes essential for autophagy.

  • Conformational changes: Phosphorylation can induce conformational changes that affect protein function. Phospho-mimetic mutations (S→D or S→E) or phospho-deficient mutations (S→A) can be used to study these effects.

To systematically study the impact of phosphorylation sites:

  • Generate single and combinatorial phosphorylation site mutants using site-directed mutagenesis

  • Assess each mutant for:

    • Protein localization and trafficking using fluorescence microscopy

    • Autophagy function using GFP-Atg8 processing assays

    • Protein-protein interactions via co-immunoprecipitation studies

    • In vivo phosphorylation status through phospho-specific antibodies or mass spectrometry

The extensive phosphorylation pattern of S. pombe atg9 (with at least 9 documented phosphorylation sites) suggests complex regulatory mechanisms that likely respond to different autophagy-inducing conditions .

How can multi-omics approaches be applied to study S. pombe atg9 function?

Multi-omics approaches offer powerful strategies to comprehensively understand S. pombe atg9 function within the broader autophagy network:

  • Integrated transcriptomic and proteomic profiling: Compare wild-type and atg9Δ strains under different autophagy-inducing conditions (such as nitrogen starvation) to identify genes and proteins whose expression depends on atg9. Similar approaches in S. cerevisiae revealed 290 and 256 genes markedly regulated by ATG9 at transcriptional and translational levels, respectively .

  • Interactomics: Use techniques like BioID, AP-MS, or yeast two-hybrid screening to map the atg9 interactome. Integration with expression data can identify functional interaction partners as demonstrated by the iFIP (inference of functional interacting partners) method developed for S. cerevisiae .

  • Phosphoproteomics: Quantitative phosphoproteomic analysis comparing wild-type and atg9Δ strains can reveal signaling pathways affected by atg9 deletion and identify substrates of kinases that function in the same pathways as atg9.

  • Metabolomics: Analyze metabolic changes in atg9Δ strains to understand how autophagy defects impact cellular metabolism.

  • Machine learning integration: Develop computational methods similar to iFIP that integrate multiple data types to predict functional relationships and discover new autophagy regulators .

Implementation of these approaches requires careful experimental design:

  • Time-series sampling to capture dynamic changes during autophagy induction

  • Appropriate controls and biological replicates

  • Standardized culture conditions and synchronized cell populations

  • Advanced computational methods for data integration and analysis

Such integrated approaches can reveal unexpected connections between atg9 and other cellular processes, as demonstrated by the discovery of Glo3 and Scs7 as functional autophagy regulators in S. cerevisiae .

What is the role of S. pombe atg9 in the context of Atg1 kinase activation?

The relationship between S. pombe atg9 and Atg1 kinase activation represents an important area for investigation, with initial insights available from the search results:

  • Atg1 kinase pathway in S. pombe: In S. pombe, Atg1 kinase activity requires Atg11 (the ortholog of mammalian FIP200/RB1CC1), with Atg1 from atg11Δ mutants showing almost undetectable autophosphorylation activity. Interestingly, Atg1 from atg13Δ, atg17Δ, or atg101Δ mutants exhibited normal autophosphorylation activities, unlike in S. cerevisiae where Atg13 and Atg17 are required for Atg1 activation .

  • Potential atg9-Atg1 interaction: While the search results don't directly address the interaction between atg9 and Atg1 in S. pombe, by extrapolation from other yeast systems, atg9 likely functions in the same pathway as Atg1, potentially influencing its activation or localization.

  • Experimental approaches to investigate this relationship:

    • Analyze Atg1 kinase activity and phosphorylation status in atg9Δ strains

    • Examine atg9 phosphorylation in Atg1 kinase-dead mutants

    • Study the localization dependency between atg9 and Atg1/Atg11

    • Perform genetic interaction studies with double mutants

    • Investigate whether Atg11(522-583), which is sufficient for Atg11's autophagy function, mediates interactions with atg9

  • Mechanistic model: In S. pombe, Atg1 can be activated by dimerization-induced cis-autophosphorylation. Understanding how atg9 interfaces with this activation mechanism represents an important research direction .

Further investigations should explore whether atg9 affects Atg1 dimerization, localization, or association with other components of the Atg1 kinase complex, and whether atg9 vesicles serve as platforms for Atg1 activation in S. pombe.

How does S. pombe atg9 differ from its homologs in other organisms?

S. pombe atg9 shows both conserved and divergent features compared to its homologs in other organisms:

  • Comparison with S. cerevisiae Atg9:

    • Both are multispanning membrane proteins essential for autophagy

    • While S. cerevisiae Atg9 has been shown to interact with numerous proteins including other Atg proteins to form seeds that establish membrane contact sites for phagophore formation, S. pombe atg9 likely functions similarly though with potentially different interaction partners

    • The regulation of Atg9 trafficking differs between species, with unique protein machinery controlling its movement

  • Comparison with mammalian ATG9:

    • Mammalian ATG9 exists in two isoforms (ATG9A and ATG9B) with different tissue distribution

    • While the core function in autophagosome formation is conserved, mammalian ATG9 trafficking involves the AP-4 complex and other factors not present in yeasts

    • Mammalian ATG9 has additional roles in immunity and inflammation not observed in yeasts

  • Structural conservation and divergence:

    • The transmembrane topology is generally conserved across species

    • The cytosolic domains show greater divergence, reflecting adaptation to different interacting partners

    • Post-translational modification sites differ significantly, with S. pombe atg9 having a unique pattern of phosphorylation sites

  • Regulatory mechanisms:

    • S. pombe shows distinct requirements for Atg1 complex components compared to S. cerevisiae, suggesting divergent regulatory pathways for atg9 function

    • The N-glycosylation at N93 in S. pombe atg9 represents a modification not commonly reported in other yeast atg9 homologs

Understanding these differences is crucial for translating findings between model systems and for identifying conserved mechanisms that might be relevant to human health and disease.

Can S. pombe atg9 be used as a model for studying human ATG9 function?

S. pombe atg9 offers both advantages and limitations as a model for studying human ATG9 function:

Advantages:

  • Cellular organization: S. pombe has a cellular organization more similar to mammalian cells than S. cerevisiae in some respects, including linear cell division and aspects of cytoskeletal organization, potentially making certain trafficking processes more translatable.

  • Genetic tractability: The fission yeast system allows for easy genetic manipulation, enabling rapid testing of hypotheses about conserved mechanisms. The extensive post-translational modification pattern of S. pombe atg9, including multiple phosphorylation sites, provides opportunities to study regulatory mechanisms potentially relevant to human ATG9 .

  • Simplified system: The reduced complexity compared to mammalian systems allows isolation of core conserved functions from mammalian-specific elaborations.

Limitations:

  • Evolutionary distance: Despite being eukaryotes, yeasts diverged from the human lineage approximately 1 billion years ago, resulting in significant differences in cellular processes.

  • Specialized functions: Human ATG9 has evolved additional functions in immunity, inflammation, and neuronal homeostasis that cannot be modeled in yeast.

  • Interaction partners: Many mammalian ATG9 interaction partners have no yeast homologs, limiting studies of these specific protein-protein interactions.

Best research applications:

  • Core mechanisms: Studying fundamental aspects of ATG9 trafficking, membrane recruitment, and its role in autophagosome formation.

  • Mutational analysis: Testing the functional impact of conserved residues, particularly those implicated in human disease.

  • Drug screening: Identifying compounds that modify ATG9 function in a genetically tractable system before advancing to more complex models.

  • Regulatory pathway discovery: Uncovering new regulators of autophagy through genetic screens that can then be examined in mammalian systems.

To maximize translational value, findings in S. pombe should be validated in mammalian systems to determine conservation of the identified mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.