Recombinant Schizosaccharomyces pombe Cell wall integrity and stress response component 1 (wsc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
wsc1; SPBC30B4.01c; SPBC3D6.14c; Cell wall integrity and stress response component 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-374
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
wsc1
Target Protein Sequence
DMNTQYGCYLVDSSLTEQGTFTYLDPAYCYNNICGGSDNIAFVAIRNNQCYCGSTLTATE VSSSLCTTPCPGYGSLMCGGDLYWSVYLTGNGVLQTTVSSSSVSSTTSSSSSSSPSSSST TTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVP ITSSTSSSHSSSSSSSSSSSSSSRPSSSSSFITTMSSSTFISTVTVTPSSSSSSTSSEVP SSTAALALNASKASNHTSLNAGAIVGIVIGCVAFAVVMALCIFLYFYFRRFKIRMSDSAN EGKYPSYASELDSRLDPAMMNRKSSESLADSQDYSRKILRVTNLN
Uniprot No.

Target Background

Gene References Into Functions
  1. The fission yeast cell wall stress sensor-like proteins Mtl2 and Wsc1 activate the GTPase Rho1p independently of the cell wall integrity pathway. PMID: 23907979
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the fundamental role of Wsc1 in Schizosaccharomyces pombe?

Wsc1 functions as a plasma membrane-associated serine-rich cell wall mechanosensor that is primarily located at active growth sites and the division septum in S. pombe. It serves as a critical sensor that detects perturbations at the cell wall and plasma membrane, subsequently transmitting signals through Rgf1 (a Rho1 GEF) to activate downstream pathways . This sensing mechanism is essential for yeast survival under stressful conditions that affect cell wall reorganization, making Wsc1 a key component of the cell's stress response system .

How does Wsc1 structurally differ from other cell wall sensors in S. pombe?

Wsc1 is one of two main cell wall stress sensor-like proteins in S. pombe, alongside Mtl2. While both are serine-rich sensors, they differ in their cellular localization patterns: Wsc1 predominantly localizes to active growth sites and the division septum, whereas Mtl2 is distributed throughout the cellular periphery . This distinct localization pattern suggests specialized roles for each sensor in detecting different types of cell wall perturbations. The structural differences between these sensors enable the fission yeast to respond appropriately to various types of cell wall stresses .

What are the optimal vectors and strategies for recombinant expression of wsc1 in S. pombe?

For effective recombinant expression of wsc1 in S. pombe, the nmt1 promoter system offers excellent control through thiamine-regulated expression. For experiments requiring overexpression, vectors like pAL-wsc1+ (such as pCL10) can be modified with site-directed mutagenesis to introduce appropriate restriction sites (e.g., XhoI and SmaI) flanking the wsc1 ORF . When designing expression constructs, it's critical to consider that the cellular localization of Wsc1 is essential for its function. For more precise integration targeting, modified transformation procedures can increase efficiency approximately 5-fold when using antibiotic-based dominant selection markers . For strains requiring genomic tagging, one-step gene replacement techniques using vectors like pRZ11 (containing GFP-tagged wsc1) offer effective approaches for studying localization and dynamics .

How can I improve gene targeting efficiency when working with wsc1 constructs?

To significantly improve gene targeting efficiency when working with wsc1 constructs, consider removing pku70+ and pku80+ genes, which encode DNA end-binding proteins required for non-homologous end joining (NHEJ) DNA repair. This genetic modification can increase targeting efficiency up to 16-fold (from ~5% to 75-80%) . Additionally, implementing a dual selection system using the natMX6/rpl42+ cassette provides both positive and negative selection capabilities for targeted integration. For challenging loci, vector series like pINTL, pINTK, and pINTH can direct integration to specific genomic sites using different selectable markers, enhancing experimental flexibility . When designing homology arms for recombination, longer regions of homology (>500 bp) generally yield better targeting efficiency.

How does Wsc1 signal through the Cell Integrity Pathway in response to stress?

Wsc1 functions as a mechanosensor that detects cell wall perturbations and triggers signaling through the Cell Integrity Pathway (CIP) . Upon stress detection, Wsc1 transmits signals through Rgf1, a guanine nucleotide exchange factor (GEF) for Rho1 GTPase. Activated Rho1 then interacts with Pck2 (PKC ortholog), which activates the downstream MAPK cascade consisting of Mkh1 (MAPKKK), Pek1 (MAPKK), and ultimately Pmk1 (MAPK) . The activated Pmk1 becomes phosphorylated in response to multiple environmental stresses including heat, osmotic stress, oxidative stress, cell wall damage, and glucose depletion . This signaling cascade is tightly regulated by several negative modulators including phosphatases like Pmp1, Pyp1, Pyp2, Ptc1, and Ptc3, which help maintain appropriate signaling intensity and duration . The entire pathway orchestrates cell wall synthesis, maintenance, and remodeling during stress conditions.

What is the relationship between Wsc1-mediated signaling and calcium homeostasis in S. pombe?

Wsc1-mediated signaling through the Cell Integrity Pathway exhibits a complex interplay with calcium homeostasis in S. pombe. The CIP and the Ca2+/calmodulin-dependent protein phosphatase calcineurin (Ppb1) play antagonistic roles in regulating chloride homeostasis . This antagonism is evident in the characteristic vic (viable in immunosuppressant and chloride) phenotype displayed by CIP null mutants, where the absence of Pmk1 activity suppresses the chloride sensitivity typically observed in ppb1Δ mutants or wild-type cells treated with the calcineurin inhibitor FK506 . The relationship between these pathways illustrates how cell wall integrity sensing through Wsc1 is integrated with ion homeostasis mechanisms. This crosstalk ensures coordinated cellular responses to environmental changes, with calcium signaling potentially modulating cell wall remodeling activities and vice versa to maintain cellular integrity under stress conditions.

What techniques are most effective for analyzing Wsc1 dynamics and localization during cell cycle progression?

For analyzing Wsc1 dynamics and localization during cell cycle progression, a multi-faceted approach combining genomic GFP tagging with live-cell imaging techniques provides the most comprehensive insights. Begin by creating strains with genomic GFP-tagged wsc1 using one-step gene replacement with vectors like pRZ11, ensuring proper integration through PCR verification . For time-lapse imaging, synchronized cell populations (using techniques like lactose gradient centrifugation or hydroxyurea block and release) allow visualization of Wsc1-GFP localization throughout the cell cycle. Complementary approaches include co-localization studies with markers for specific cellular structures (e.g., membranes, septum, endosomes) to define the precise subcellular compartments where Wsc1 functions. For quantitative analysis, fluorescence recovery after photobleaching (FRAP) can assess protein mobility and turnover rates at different cell cycle stages. These approaches collectively provide a comprehensive understanding of how Wsc1 localization changes dynamically during growth, division, and in response to stress conditions.

How can I establish a synthetic genetic array to identify novel interactors of wsc1?

To establish a synthetic genetic array for identifying novel interactors of wsc1, first construct a query strain containing a marked wsc1 deletion or conditional allele (using techniques like the natMX6 marker) . This query strain should be designed to be compatible with automated mating approaches and contain appropriate selectable markers. Cross this strain systematically with a genome-wide deletion library or mutant collection of S. pombe strains. For improved integration efficiency, consider using strains with pku70+ and pku80+ deletions, which can increase gene targeting efficiency to ~75-80% . During analysis, look for synthetic sick/lethal interactions or suppressor relationships by quantitative assessment of colony size or growth rate. For conditional interactions, examine growth under various stress conditions (heat, osmotic stress, cell wall-damaging agents) which may reveal context-specific genetic relationships. Validate key interactions through targeted gene deletions, co-immunoprecipitation, or co-localization studies. This approach can reveal functional connections between Wsc1 and components of other cellular pathways beyond the established Cell Integrity Pathway.

What is the specific role of Wsc1 in response to different categories of cell wall stressors?

Wsc1 exhibits differential responses to various categories of cell wall stressors, playing a crucial role in the cellular adaptation to specific types of cell wall damage. During exposure to β-glucan synthesis inhibitors like Caspofungin, Wsc1 activates compensatory mechanisms through Rgf1 and Rho1 to increase production of cell wall components via alternative synthases . When facing heat stress, Wsc1 contributes to thermal adaptation by sensing membrane fluidity changes that affect cell wall-membrane interactions. In response to osmotic stress, Wsc1 activates the CIP, leading to Pmk1 phosphorylation, which works in concert with or antagonistically to the stress-activated protein kinase pathway depending on the specific stress context . During oxidative stress, Wsc1-mediated signaling helps maintain cellular integrity against reactive oxygen species that can damage cell wall components. This functional specificity allows S. pombe to mount appropriate and proportional responses to different categories of environmental challenges.

How do deletion mutants of wsc1 compare to wild-type strains in growth and stress survival assays?

Deletion mutants of wsc1 display distinctive phenotypes compared to wild-type strains in growth and stress survival assays, reflecting Wsc1's specific contributions to cell integrity. The table below summarizes key phenotypic differences:

ConditionWild-type phenotypewsc1Δ phenotypeMolecular basis
Normal growthNormal morphology and division rateMinor morphological abnormalitiesPartial redundancy with Mtl2 sensor
Heat stress (36-40°C)Adapted growthModerate sensitivityCompromised CIP activation through Pmk1
Cell wall damage (Caspofungin)ResistantHypersensitiveDefective cell wall remodeling response
Osmotic stress (high salt)ResistantSensitiveImpaired chloride homeostasis
Calcineurin inhibition (FK506)Sensitive to chlorideViable in immunosuppressant and chloride (vic phenotype)Antagonistic relationship between CIP and calcineurin
Oxidative stressResistantModerately sensitiveReduced CIP activation

These phenotypic differences highlight the role of Wsc1 in coordinating responses to various stressors, with particularly pronounced effects on cell wall integrity maintenance under challenging conditions .

What methods can determine whether Wsc1 directly interacts with Rgf1 or requires intermediate proteins?

To determine whether Wsc1 directly interacts with Rgf1 or requires intermediate proteins, a multi-methodological approach is necessary. Begin with co-immunoprecipitation (co-IP) using strains expressing tagged versions of Wsc1 (e.g., Wsc1-GFP) and Rgf1 (e.g., Rgf1-HA) . This approach would identify whether these proteins exist in the same complex. For direct interaction analysis, implement in vitro binding assays using purified recombinant domains of both proteins. Complementary approaches include yeast two-hybrid assays or proximity ligation assays in vivo. For mapping the interaction domains, construct a series of truncated or mutated versions of both proteins and test their interaction capabilities. To identify potential intermediate proteins, perform mass spectrometry analysis of Wsc1-containing complexes isolated from cells under both normal and stress conditions. Finally, FRET (Fluorescence Resonance Energy Transfer) microscopy using appropriately tagged proteins can confirm direct interactions in living cells and map where in the cell these interactions occur. This comprehensive approach would definitively establish whether Wsc1-Rgf1 interaction is direct or mediated by other components.

How does the signaling cascade differ between Wsc1 and Mtl2 activation in S. pombe?

AspectWsc1 signalingMtl2 signaling
Primary localizationGrowth sites, division septumCellular periphery
Primary GTPase activationRho1, indirect Rho2Primarily Rho1
PKC isoform preferenceStronger effect on Pck2Influences both Pck1 and Pck2
Response to stress typesMore responsive to heat, cell wall damageMore responsive to mechanical stress
Phenotypic severity when deletedModerate cell wall defectsMore severe morphological problems
Genetic interactionsSynthetic effects with rgf1ΔSynthetic effects with rho1 mutations

These differences illustrate how S. pombe has evolved specialized cell wall sensing mechanisms that enable appropriate responses to diverse environmental challenges by activating partially overlapping but distinct signaling cascades .

What post-translational modifications of Wsc1 are critical for signal transduction?

Several post-translational modifications (PTMs) of Wsc1 play critical roles in regulating its signaling capacity in the Cell Integrity Pathway. The serine-rich extracellular domain of Wsc1 undergoes O-mannosylation, which is essential for its sensing capabilities by affecting the rigidity and extension of this domain . This modification creates a "glycosylated nano-spring" that responds to mechanical forces on the cell wall. Phosphorylation of specific serine/threonine residues in the cytoplasmic tail of Wsc1 modulates its interaction with downstream effectors like Rgf1, serving as a molecular switch for signal transduction. During internalization and recycling, Wsc1 may undergo ubiquitination, which regulates its endocytic trafficking and potentially creates negative feedback loops in signaling. To study these PTMs experimentally, researchers should employ mass spectrometry-based approaches to map modification sites, followed by site-directed mutagenesis to create non-modifiable variants. Combining these mutants with functional assays for CIP activation (e.g., measuring Pmk1 phosphorylation) would establish the precise role of each modification in Wsc1-mediated signaling.

What approaches would best determine the three-dimensional structure of the Wsc1 sensing domain?

Determining the three-dimensional structure of the Wsc1 sensing domain presents significant challenges due to its highly glycosylated nature and transmembrane context. A comprehensive approach would combine multiple structural biology techniques:

How conserved is Wsc1 structure and function across different yeast species?

Wsc1 structure and function show interesting patterns of conservation and divergence across different yeast species, reflecting evolutionary adaptation to diverse ecological niches. In Schizosaccharomyces pombe, Wsc1 functions as a membrane-associated serine-rich cell wall mechanosensor located at active growth sites and the division septum . Comparing this to other yeasts reveals:

SpeciesWsc1 homologStructural featuresFunctional roleSignaling partners
S. pombeWsc1Serine-rich extracellular domain, single transmembrane domainCell wall integrity sensing, stress responseSignals through Rgf1 (Rho1 GEF)
S. japonicusWsc1Similar domain organization to S. pombeCell wall integrity, hyphal developmentSimilar CIP components to S. pombe
S. cerevisiaeWsc1 (alongside Wsc2-3, Mid2)Family expansionBroader range of stress responsesSignals through Rom1/2 to Rho1
C. albicansWsc1Additional domainsCell wall integrity, virulence, morphogenesisMore complex signaling network

This comparative analysis highlights that while the core mechanosensing function is conserved, the specificity of responses and integration with other signaling pathways has diversified during evolution. Particularly noteworthy is the expansion of the Wsc family in S. cerevisiae compared to the more streamlined system in S. pombe, suggesting differential selection pressures on cell wall sensing mechanisms across yeast lineages .

What evolutionary insights can be gained from studying Wsc1 orthologs in pathogenic fungi?

Studying Wsc1 orthologs in pathogenic fungi provides valuable evolutionary insights with potential translational applications. The cell wall sensing mechanisms represented by Wsc1 have evolved specialized features in pathogenic species that facilitate host invasion, immune evasion, and adaptation to host environments. In pathogenic fungi, Wsc1 orthologs often exhibit expanded functional roles beyond basic cell wall integrity maintenance. Many pathogenic species show additional protein domains or modified sensing regions that may enable detection of host-specific signals or environmental cues relevant to pathogenesis. The signaling networks downstream of Wsc1 orthologs in pathogens frequently integrate with virulence pathways that are absent in non-pathogenic yeasts like S. pombe. This integration suggests evolutionary co-option of cell wall sensing for pathogenicity functions. From a therapeutic perspective, understanding the unique features of Wsc1 orthologs in pathogens could identify druggable targets that would not affect commensal or beneficial fungi. Comparative genomic analyses across multiple fungal lineages could identify signatures of positive selection in Wsc1 domains that correlate with pathogenic potential, providing evolutionary markers for pathogenicity.

What are common pitfalls when attempting to purify recombinant Wsc1 protein and how can they be addressed?

Purification of recombinant Wsc1 protein presents several challenges due to its transmembrane nature and post-translational modifications. Common pitfalls and their solutions include:

  • Protein insolubility: Wsc1 is a membrane protein with a single transmembrane domain, which often leads to aggregation during expression. Solution: Express only soluble domains separately (extracellular or cytoplasmic) or use specialized membrane protein expression systems with appropriate detergents (e.g., DDM, LMNG).

  • Improper glycosylation: The extracellular domain of Wsc1 is heavily O-mannosylated in its native state, which impacts its structure and function. Solution: Express in yeast systems (P. pastoris or S. cerevisiae) rather than bacterial systems to maintain appropriate glycosylation patterns.

  • Low expression yields: Membrane proteins often express poorly. Solution: Optimize codon usage for the expression host, use strong inducible promoters like nmt1, and consider fusion tags that enhance expression (MBP or SUMO tags) .

  • Protein degradation: The cytoplasmic tail may be susceptible to proteolysis. Solution: Include protease inhibitors throughout purification and consider adding stabilizing agents like glycerol or specific ligands.

  • Contaminating proteins: Membrane proteins often co-purify with other membrane components. Solution: Implement multiple purification steps, including affinity chromatography followed by size exclusion and ion exchange chromatography.

  • Functional assessment challenges: Purified Wsc1 may lose functionality outside its native membrane environment. Solution: Reconstitute in liposomes or nanodiscs to maintain a membrane-like environment for functional studies.

These methodological approaches can significantly improve the success rate of Wsc1 purification for biochemical and structural studies.

How can I optimize transformation efficiency when creating wsc1 mutant strains?

Optimizing transformation efficiency when creating wsc1 mutant strains requires addressing several technical aspects of the S. pombe transformation process. A modified transformation procedure can lead to a 5-fold increase in efficiency when using antibiotic-based dominant selection markers . For particularly challenging constructs, removing the pku70+ and pku80+ genes can dramatically increase gene targeting efficiency from around 5% to 75-80% (a 16-fold improvement) . This approach is especially valuable for creating precise mutations in wsc1. Using a natMX6/rpl42+ cassette provides both positive and negative selection capabilities, enhancing the identification of correctly integrated constructs . When designing homology arms for recombination, aim for at least 500 bp of homology on each side of the target site. For GFP tagging of wsc1, one-step gene replacement using vectors like pRZ11 with proper verification by PCR ensures correct integration . During the transformation process, extending the heat shock duration and recovery period can improve efficiency for difficult constructs. Finally, optimizing the ratio of DNA to cells and ensuring cells are harvested in mid-logarithmic phase will further enhance transformation success rates.

What emerging technologies could advance our understanding of Wsc1 dynamic function in live cells?

Several emerging technologies hold promise for advancing our understanding of Wsc1 dynamic function in live cells:

  • Optogenetic control systems: Implementing light-activated domains into Wsc1 would enable precise temporal and spatial control of its activity, allowing researchers to trigger cell wall integrity signaling at specific cellular locations and observe downstream responses in real time.

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED microscopy would reveal the nanoscale organization of Wsc1 clusters at the cell membrane and their reorganization during stress responses, providing insights into how sensor distribution correlates with function.

  • Single-molecule tracking: Following individual Wsc1 molecules in living cells would elucidate their diffusion dynamics, clustering behavior, and interactions with downstream components like Rgf1.

  • CRISPR-based live cell genomic imaging: Adapting CRISPR systems to track the wsc1 genomic locus could reveal connections between gene expression, protein production, and localization in response to different stressors.

  • Biosensors for CIP activation: Developing FRET-based biosensors for monitoring Pmk1 activity in real time would allow correlation between Wsc1 stimulation and downstream pathway activation with unprecedented temporal resolution.

  • Microfluidic devices: Creating microfluidic platforms that apply precise mechanical forces or chemical gradients to S. pombe cells would enable quantitative analysis of Wsc1's mechanosensing properties.

These technologies, especially when used in combination, could transform our understanding of how Wsc1 dynamically coordinates cell wall integrity responses in living cells.

What are the most significant unanswered questions regarding Wsc1 function in S. pombe?

Despite considerable progress in understanding Wsc1 function, several significant questions remain unanswered:

Addressing these questions will require innovative approaches combining structural biology, advanced imaging, genetic manipulation, and systems biology to fully elucidate the complex role of Wsc1 in maintaining cellular integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.