Recombinant Schizosaccharomyces pombe Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 (SPAC19G12.08)

Shipped with Ice Packs
In Stock

Description

Introduction to Ceramide Very Long Chain Fatty Acid Hydroxylase-like Protein

Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 (SPAC19G12.08) is a protein derived from Schizosaccharomyces pombe, commonly known as fission yeast. This organism serves as an important model system in molecular biology due to its relatively simple genome and similarity to higher eukaryotes in many fundamental cellular processes. The protein is encoded by the gene designated as scs7, which indicates its role as a sphingosine hydroxylase . The gene nomenclature reflects its functional classification within the broader family of hydroxylases that act specifically on very long chain fatty acids in ceramide molecules. Ceramides are a class of sphingolipids that play essential roles in cell membrane structure and various signaling pathways, making enzymes that modify them particularly important for understanding cellular biology and potential therapeutic applications.

The designation "C19G12.08" refers to the chromosomal location and specific open reading frame (ORF) identification within the S. pombe genome, while "SPAC19G12.08" represents the systematic name assigned to this gene in the S. pombe genome database. This naming convention provides researchers with precise genomic coordinates and facilitates cross-referencing across different scientific databases and literature.

Molecular Structure and Biochemical Properties

The recombinant Ceramide very long chain fatty acid hydroxylase-like protein possesses distinct molecular characteristics that define its structure and function. This protein has been thoroughly characterized at the sequence level, with a complete amino acid sequence available through protein databases.

Predicted Enzymatic Function

Based on its classification as a ceramide very long chain fatty acid hydroxylase-like protein, this enzyme is predicted to play a key role in sphingolipid metabolism. The primary function appears to be the hydroxylation of very long chain fatty acids that are incorporated into ceramides, a process that significantly affects the biophysical properties of these lipids and their derivatives.

Hydroxylation of sphingolipids is known to influence several cellular processes, including:

  1. Membrane fluidity and microdomain organization

  2. Cell signaling through altered interaction with other membrane components

  3. Resistance to stress conditions, particularly oxidative stress

  4. Protein trafficking and localization within cellular compartments

Recombinant Protein Production

The recombinant form of Ceramide very long chain fatty acid hydroxylase-like protein is typically produced using cell-free expression systems . This approach offers several advantages for the production of membrane proteins like hydroxylases, including:

  1. Avoidance of cellular toxicity issues that often occur when overexpressing membrane proteins

  2. Direct access to the reaction environment for optimization

  3. Potential for higher yields of functional protein

  4. Reduction of contaminating proteins from host cells

Purification and Quality Control

Following expression, the recombinant protein undergoes purification procedures to achieve high purity. According to product specifications, the final purity is greater than or equal to 85% as determined by SDS-PAGE (Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis) . This analytical technique separates proteins based on their molecular weight, allowing for assessment of purity and confirmation of the expected size of the target protein.

The purified protein is typically formulated in a Tris-based buffer containing 50% glycerol, which helps stabilize the protein structure and prevent denaturation during storage . This formulation is optimized specifically for this protein to maintain its structural integrity and functional activity.

Research Applications

The recombinant protein has potential applications in various research areas, including:

  1. Enzymatic Assays: To study the hydroxylation activity on various substrates and determine kinetic parameters

  2. Structural Studies: As a starting material for crystallography or other structural biology techniques

  3. Antibody Production: For generating specific antibodies against this protein

  4. Protein-Protein Interaction Studies: To identify binding partners and regulatory networks

  5. Drug Screening: As a target for identifying inhibitors or activators that might have therapeutic potential

Functional Validation

While the protein is classified as a ceramide very long chain fatty acid hydroxylase based on sequence homology, direct experimental validation of its enzymatic activity would be beneficial. Future studies might focus on:

  1. Confirming the specific hydroxylation reactions catalyzed

  2. Identifying the precise substrates and their chain-length preferences

  3. Determining the regiospecificity of the hydroxylation reaction

  4. Investigating potential regulatory mechanisms that control its activity

Biological Role in S. pombe

Further research into the biological significance of this protein in S. pombe might explore:

  1. The effects of gene knockout or overexpression on cell physiology

  2. Changes in sphingolipid profiles in response to environmental stresses

  3. Potential interactions with other enzymes involved in sphingolipid metabolism

  4. The role of sphingolipid hydroxylation in cell wall integrity and stress response

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
scs7; SPAC19G12.08; Ceramide very long chain fatty acid hydroxylase scs7; Ceramide VLCFA hydroxylase scs7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-347
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC19G12.08
Target Protein Sequence
MASVTSEKCVILSDGTEYDVTNYLVANKDAADLLRRYHRQEVADILNATSKSKHSEAVVE ILKSAKVPLKNKEFSDLVDQNIGVGYGNEFIVKPTDLDKDFEKNHFLDLKKPLLPQILFG NIKKDVYLDQVHRPRHYRGSGSAPLFGNFLEPLTKTPWYMIPLIWVPCVTYGFLYACTGI PFSVAITFFIIGLFTWTLVEYTMHRFLFHLDEYTPDHPIFLTMHFAFHGCHHFLPADKYR LVMPPALFLIFATPWYHFIQLVLPHYIGVAGFSGAILGYVFYDLTHYFLHHRRMPNAYLT DLKTWHLDHHYKDYKSAYGITSWFWDRVFGTEGPLFNEQGKISTKAK
Uniprot No.

Target Background

Function
Ceramide hydroxylase participates in the hydroxylation of sphingolipid-associated very long chain fatty acids. It is believed to hydroxylate the very long chain fatty acid of dihydroceramides and phytoceramides at the C-2 position.
Database Links
Protein Families
Sterol desaturase family, SCS7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What experimental systems are appropriate for studying S. pombe proteins like SPAC19G12.08?

S. pombe has emerged as a valuable experimental system in eukaryotic molecular biology, comparable to bacterial systems in molecular research applications . When studying SPAC19G12.08 specifically, researchers should consider:

  • Homologous expression systems: Using S. pombe itself as an expression host preserves native post-translational modifications and cellular environments.

  • Heterologous expression systems: E. coli, Saccharomyces cerevisiae, or mammalian cell lines can be employed depending on research objectives.

  • Knockout and knockdown approaches: Gene deletion or RNAi-mediated silencing helps elucidate function through phenotypic analysis.

  • Genomic tagging methods: Adding epitope or fluorescent tags enables subcellular localization and interaction studies.

The choice depends on research objectives, with homologous systems being preferred for functional studies and heterologous systems for higher protein yields or specific analytical requirements.

How should I design expression experiments for recombinant SPAC19G12.08 protein?

When designing expression experiments for SPAC19G12.08, consider these methodological guidelines:

  • Vector selection: For S. pombe expression, use vectors with appropriate promoters (nmt1, adh1) and selection markers. For heterologous systems, codon optimization may be necessary.

  • Expression conditions:

    • Temperature: 30°C is optimal for S. pombe

    • Media composition: EMM (Edinburgh Minimal Medium) with appropriate supplements

    • Induction parameters: For thiamine-repressible promoters (nmt), remove thiamine 16-24 hours prior to harvesting

  • Protein extraction considerations: As a membrane-associated protein, use detergent-based lysis buffers (e.g., 1% Triton X-100 or CHAPS) to solubilize effectively.

  • Purification strategy: Implement a two-step purification using affinity chromatography followed by size exclusion or ion exchange chromatography.

Expression SystemAdvantagesDisadvantagesRecommended MediaTypical Yield
S. pombeNative folding, PTMsLower yieldsEMM0.5-2 mg/L
E. coliHigh yield, easy handlingPossible misfoldingLB or TB5-10 mg/L
S. cerevisiaeEukaryotic PTMsPotential glycosylation differencesYPD or SC2-5 mg/L

What are the critical factors in designing quasi-experimental studies involving SPAC19G12.08?

When a true experimental design isn't feasible for studying SPAC19G12.08 function, quasi-experimental approaches offer practical alternatives. Consider these methodological guidelines:

  • Nonequivalent comparison groups: When random assignment isn't possible, carefully select comparison groups with similar characteristics to minimize confounding variables .

  • Time-series analysis: Monitor expression levels or phenotypes over multiple time points before and after manipulation of SPAC19G12.08.

  • Matched-pairs design: Match experimental units based on relevant variables (growth conditions, genetic background) before applying treatments.

  • Controls for genomic integration: When using integration-based expression systems, control for integration site effects by generating multiple independent integrants.

  • Validation strategy: Implement multiple methodological approaches to validate findings:

    • Complement knockout strains with wild-type and mutant variants

    • Use both overexpression and downregulation approaches

    • Confirm phenotypes with independent alleles or constructs

Remember that quasi-experimental designs inherently have limitations in establishing causality compared to true experimental designs with random assignment .

How should I analyze enzymatic activity data for SPAC19G12.08 protein?

When analyzing enzymatic activity of SPAC19G12.08, follow these methodological steps:

  • Substrate preparation: Prepare very long chain fatty acids (C22-C26) conjugated to appropriate reporters or attached to ceramide backbones.

  • Reaction optimization:

    • Buffer conditions: Test pH range 6.5-8.0

    • Cofactor requirements: Assess dependence on NAD(P)H, O₂, Fe²⁺

    • Temperature: Typically 25-30°C for S. pombe enzymes

  • Data analysis approach:

    • Calculate specific activity (μmol/min/mg protein)

    • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten or Lineweaver-Burk plots

    • Evaluate competitive inhibitors to confirm binding site specificity

  • Controls and normalization:

    • Include heat-inactivated enzyme controls

    • Use catalytically inactive mutants (e.g., predicted active site mutations)

    • Normalize activity to protein concentration determined by Bradford or BCA assay

  • Statistical analysis: Apply appropriate statistical tests (ANOVA for multiple conditions, t-tests for pairwise comparisons) with correction for multiple testing if applicable.

How do I resolve contradictory data when studying SPAC19G12.08 localization?

When faced with contradictory localization data for SPAC19G12.08, implement this systematic approach:

  • Methodological comparison:

    • Compare fixation methods: Paraformaldehyde vs. methanol fixation can affect membrane protein epitope accessibility

    • Evaluate tag interference: N-terminal vs. C-terminal tags may differentially affect localization

    • Assess expression levels: Overexpression can cause artifactual localization patterns

  • Multi-method validation:

    • Complement fluorescence microscopy with subcellular fractionation

    • Use multiple independent antibodies or different tag types

    • Perform correlative light and electron microscopy for high-resolution confirmation

  • Functional validation:

    • Determine if protein function is preserved in tagged constructs

    • Design mutations that should alter localization based on predicted targeting sequences

    • Use temperature-sensitive alleles to track dynamic localization changes

  • Conflict resolution framework:

    • Prioritize data from native expression levels over overexpression

    • Consider cell cycle or growth condition dependencies

    • Evaluate consistency with known interacting partners' localizations

What approaches should I use to identify functional domains in SPAC19G12.08?

To systematically identify and characterize functional domains in SPAC19G12.08, implement this multifaceted strategy:

  • Computational prediction:

    • Perform sequence-based domain prediction (PFAM, SMART, InterPro)

    • Identify conserved motifs through multiple sequence alignments with orthologs

    • Use structural prediction algorithms (AlphaFold, I-TASSER) to map potential binding pockets

  • Experimental validation:

    • Generate a deletion series targeting predicted domains

    • Create point mutations in catalytic residues or binding sites

    • Design chimeric proteins swapping domains with related hydroxylases

  • Functional assays:

    • Measure enzymatic activity of truncated and mutant proteins

    • Assess membrane integration using protease protection assays

    • Determine protein-protein interactions using yeast two-hybrid or co-immunoprecipitation

  • Domain-specific analysis table:

Predicted DomainPositionPredicted FunctionValidation MethodExpected Outcome if Disrupted
Transmembrane118-140Membrane anchoringTopology mappingMislocalization
Hydroxylase motif210-245Catalytic activityPoint mutationsLoss of enzymatic activity
Fe-binding site268-272Cofactor bindingMetal chelation assaysReduced activity with EDTA
C-terminal regulatory310-347Protein interactionsTruncationAltered regulation

How can I establish structure-function relationships for SPAC19G12.08 in ceramide metabolism?

To establish structure-function relationships for SPAC19G12.08, implement these methodological approaches:

  • Structural analysis:

    • Generate homology models based on related hydroxylases

    • Identify conserved structural elements across fungal species

    • Map mutations onto the structural model to predict functional impacts

  • Substrate specificity determination:

    • Test activity on varying chain length ceramides (C18-C26)

    • Examine position specificity of hydroxylation using LC-MS/MS

    • Evaluate stereospecificity using chiral chromatography

  • Mutational analysis strategy:

    • Create alanine-scanning mutants across predicted active site

    • Generate conservative and non-conservative substitutions at key residues

    • Design mutations that alter substrate binding without affecting catalysis

  • Functional ceramide metabolic analysis:

    • Quantify ceramide species profiles in wild-type vs. mutant cells

    • Measure flux through ceramide pathways using labeled precursors

    • Correlate enzyme kinetics with in vivo ceramide composition

  • Phenotypic correlation:

    • Assess membrane fluidity in mutants using fluorescence anisotropy

    • Evaluate stress responses dependent on ceramide modifications

    • Investigate protein interactions within the ceramide synthesis complex

How do I overcome expression and solubility challenges with SPAC19G12.08?

When facing expression and solubility challenges with SPAC19G12.08, implement these methodological solutions:

  • Expression optimization:

    • Reduce expression temperature (16-20°C) to slow folding and prevent aggregation

    • Use weaker promoters to prevent overwhelming membrane insertion machinery

    • Add stabilizing ligands or inhibitors during expression

    • Consider fusion tags (MBP, SUMO) known to enhance solubility

  • Membrane protein solubilization strategy:

    • Screen detergent panel (mild to harsh): DDM, LMNG, CHAPS, SDS

    • Try detergent-free alternatives: SMALPs (styrene-maleic acid lipid particles)

    • Test mixed micelle systems: lipid-detergent combinations

    • Optimize detergent-to-protein ratios systematically

  • Refolding approach if inclusion bodies form:

    • Solubilize in mild denaturants (2M urea) rather than harsh conditions

    • Use step-wise dialysis with decreasing denaturant concentrations

    • Add lipids during refolding to promote proper membrane integration

    • Include molecular chaperones (GroEL/ES) during refolding

  • Functional verification:

    • Develop activity assays compatible with detergent-solubilized protein

    • Verify proper folding using limited proteolysis patterns

    • Implement thermal shift assays to assess stability in various conditions

What strategies should I use to investigate protein-protein interactions involving SPAC19G12.08?

To effectively investigate protein-protein interactions involving SPAC19G12.08, implement these methodological approaches:

  • In vivo interaction methods:

    • Bimolecular Fluorescence Complementation (BiFC) for direct visualization

    • Proximity Labeling (BioID, APEX) to identify neighboring proteins

    • Co-immunoprecipitation with membrane-compatible crosslinkers

    • Genetic interaction screens to identify functional partners

  • In vitro validation approaches:

    • Pull-down assays using recombinant protein fragments

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Blue Native PAGE to preserve membrane protein complexes

  • Interaction mapping strategy:

    • Define minimal interaction domains through truncation analysis

    • Identify critical residues using alanine scanning mutagenesis

    • Verify specificity using competition assays with synthetic peptides

    • Assess interaction dynamics during cell cycle or stress conditions

  • Data integration framework:

    • Correlate physical interactions with genetic interaction profiles

    • Map interactions onto metabolic pathways related to ceramide synthesis

    • Cross-validate findings using orthogonal methods

    • Compare interaction networks across fungal species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.