Recombinant Schizosaccharomyces pombe Copper transport protein ctr6 (ctr6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctr6; SPBC23G7.16; Copper transport protein ctr6; Copper transporter 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
ctr6
Target Protein Sequence
MNHGGNSTMRHCSMKMTFNTDYDNLCIVFKSWHIGNLSQFLLSLLAIAILGYLFERLRSF TSLKETEFQRGYAGQQSEGLLTHHSKSLKSGRPFRLCALYAVQLVFSYFLMLVAMTYNAY VILAIAIGAAFGYRRSHCDTVQTVGLCH
Uniprot No.

Target Background

Function
This protein mobilizes stored copper from the vacuole to the cytoplasm under conditions of copper limitation.
Gene References Into Functions
  1. Novel regulatory targets for Cuf1p (pex7 and SPAC3G6.05) and Fep1p (srx1, sib1, sib2, rds1, isu1, SPBC27B12.03c, SPAC1F8.02c, and SPBC947.05c) were identified in Schizosaccharomyces pombe. PMID: 17477863
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of Ctr6 in Schizosaccharomyces pombe and where is it localized?

    Ctr6 is a vacuolar membrane copper transporter in Schizosaccharomyces pombe that mobilizes stored copper from the vacuole to the cytosol under copper-limiting conditions. Using functional epitope-tagged alleles expressed under native promoter control, researchers have localized Ctr6 specifically to the vacuolar membrane during vegetative growth . Unlike plasma membrane-localized transporters that mediate copper uptake from the external environment, Ctr6 plays a crucial role in utilizing intracellular copper stores when environmental copper becomes scarce .

  • How is Ctr6 expression regulated at the transcriptional level?

    The transcription of the ctr6+ gene is induced under copper-limiting conditions through a mechanism mediated by the cis-acting promoter element CuSE (copper-signaling element) and the copper-sensing transcription factor Cuf1 . During meiosis, ctr6+ expression exhibits a broader pattern, being detected throughout the entire meiotic process with increased expression during middle- and late-phase meiosis . Interestingly, while ctr4+ and ctr5+ expression is exclusively dependent on Cuf1, ctr6+ gene expression relies on two distinct regulators: Cuf1 and Mei4 , indicating a more complex regulatory mechanism for this vacuolar transporter.

  • What is the structural organization of the Ctr6 protein?

    Ctr6 is an integral membrane protein with the capacity to trimerize . The predicted topology of Ctr6 suggests it possesses three transmembrane domains (TMDs) and conserved motifs characteristic of the Ctr family of copper transporters, including a MX₃M motif in TMD2 and a GX₃G motif in TMD3 . These motifs are believed to be responsible for copper transport function and homotrimer assembly, respectively. Additionally, Ctr6 harbors a putative copper-binding Met-X-His-Cys-X-Met-X-Met motif in its amino terminus, which has been experimentally demonstrated to be essential for its function .

Intermediate Research Questions

  • How does Ctr6 differ from other copper transporters in S. pombe?

    S. pombe possesses three members of the copper transporter (Ctr) family: Ctr4, Ctr5, and Ctr6. While Ctr4 and Ctr5 form a heteromeric complex at the plasma membrane to facilitate copper uptake from the extracellular environment, Ctr6 functions at the vacuolar membrane to mobilize stored copper . Their functions are also temporally distinct during meiosis: Ctr4 and Ctr5 proteins co-localize at the plasma membrane shortly after meiotic induction and then progressively disappear after 3 hours, whereas Ctr6 localizes to vacuolar membranes in early meiosis and then undergoes redistribution to reach forespore membranes where it persists until sporulation . This differential localization and temporal expression indicate specialized roles in copper homeostasis throughout the yeast lifecycle.

  • What experimental approaches are most effective for studying Ctr6 localization?

    Researchers have successfully employed several complementary techniques to study Ctr6 localization:

    • Epitope tagging: Expression of functional HA₄-tagged Ctr6 under its own promoter allows for tracking without disrupting native function .

    • Indirect immunofluorescence microscopy: This technique has been effectively used to visualize Ctr6-HA₄ in both mitotically growing cells and during meiotic progression .

    • Co-localization studies: Using GFP-Psy1 (an intrinsic component of forespore membrane) alongside Ctr6-HA₄ has confirmed Ctr6's localization to the forespore membrane during late meiosis .

    • Synchronous meiotic induction: Employing temperature-sensitive pat1-114 mutants allows for simultaneous entry into meiosis, facilitating time-course tracking of Ctr6 localization changes .

  • What phenotypes are observed in ctr6Δ mutant strains?

    Deletion of the ctr6+ gene results in several distinct phenotypes:

    • Reduced SOD1 activity: A strain bearing a disrupted ctr6Δ allele displays a significant reduction in copper,zinc superoxide dismutase activity .

    • Synergistic effects with other copper transporter deletions: In a ctr4Δ ctr6Δ double mutant, SOD1 activity is completely lost, revealing that both transporters contribute to providing copper to cytosolic copper-dependent enzymes .

    • CAO activity deficiency: Under copper-limiting conditions, ctr6Δ cells exhibit reduced copper amine oxidase (CAO) activity, particularly in early and middle-phase meiosis .

    • Normal Cao1 protein levels: Despite reduced activity, the steady-state protein levels of Cao1 remain similar in wild-type and ctr6Δ mutant strains, indicating that the defect is in copper delivery rather than protein expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.