Recombinant Schizosaccharomyces pombe Cytochrome c oxidase assembly protein cox16, mitochondrial (cox16)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Schizosaccharomyces pombe cox16 is a cell-free expressed protein (≥85% purity) derived from the fission yeast Schizosaccharomyces pombe. It is encoded by the nuclear gene cox16 (systematic name: SPAC1486.08) and functions as a mitochondrial inner membrane protein essential for COX assembly .

PropertyDetails
Gene Namecox16 (SPAC1486.08)
Protein ClassCytochrome c oxidase assembly factor
Host SystemCell-free expression
Purity≥85% (SDS-PAGE verified)
LocalizationMitochondrial inner membrane, intermembrane space-facing domain

Functional Role in Cytochrome c Oxidase (COX) Assembly

COX16 is required for the formation of the COX2 subassembly module and facilitates copper delivery to the COX2 subunit :

  • Copper Metallation: COX16 interacts with copper chaperones SCO1, SCO2, and COA6 to assist in Cu<sub>A</sub> site formation in COX2 .

  • Module Integration: It mediates the merging of COX1 (encoded mitochondrially) and COX2 assembly lines, ensuring proper holoenzyme formation .

  • Redundancy: Partial COX activity persists in COX16-knockout cells, suggesting functional overlap with other assembly factors .

Copper-Dependent Rescue

  • Copper supplementation restores COX activity in COX16-deficient cells, highlighting its indirect role in metal ion homeostasis .

Disease Relevance

  • Mutations in COX assembly factors (e.g., SCO1, COA6) linked to mitochondrial disorders disrupt COX16 interactions, underscoring its clinical relevance .

Applications and Availability

This recombinant protein is commercially available for biochemical studies (e.g., protein-protein interaction assays, enzyme activity assays):

Product IDHost SystemSupplierReference
MBS7077007E. coli, Yeast, Baculovirus, MammalianMyBioSource
MBS7082160E. coli, Yeast, Baculovirus, MammalianMyBioSource
CB115632727Cell-free expressionChemicalBook

Comparative Analysis of COX16 Studies

StudyKey ContributionMethodology
Stiburek et al. (2018) Identified COX16’s role in COX2 metallation and module integrationBN-PAGE, immunoisolation, SILAC-MS
Carlson et al. (2003) First characterization of yeast Cox16p as essential for COX assemblyGene knockout, mitochondrial assays
Su et al. (2017) Demonstrated physical association of Cox16p with COX1 intermediates in yeastAffinity purification, BN-PAGE

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery details, kindly consult your local distributors.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cox16; SPAC1486.08; Cytochrome c oxidase assembly protein cox16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-113
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cox16
Target Protein Sequence
QAKKSPFIYVGLPFLSSVLLVWSCLIPISQVKFNRRDEQVKSLSRDAELDIIKRRRKVDV NEEYYRILLDQLNLQNEEYENKRVKRLKGEPTWEGNSSDKE
Uniprot No.

Target Background

Function
Cox16 is essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may play a role in merging the COX1 and COX2 assembly lines.
Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the cellular localization of Cox16 in S. pombe mitochondria?

Cox16 is an integral inner mitochondrial membrane protein with its C-terminus facing the intermembrane space (IMS). The protein lacks a predictable N-terminal presequence that is typically found in its S. cerevisiae homolog. This localization can be experimentally determined through hypo-osmotic swelling and carbonate extraction techniques, where Cox16 remains resistant to carbonate extraction (indicating membrane integration) and only becomes accessible to protease treatment when the outer membrane is disrupted . These findings confirm that Cox16 contains a predicted single transmembrane span anchoring it to the inner mitochondrial membrane.

What are the primary functions of Cox16 in cytochrome c oxidase assembly?

Cox16 serves dual critical functions in the assembly of cytochrome c oxidase. First, it facilitates the association of metallochaperones (particularly SCO1) with newly synthesized COX2, implicating it in copper center formation. Second, Cox16 mediates the merging of independent COX1 and COX2 assembly pathways, functioning at the interface between these two crucial processes . In S. pombe, Cox16 specifically interacts with newly synthesized Cox2 rather than Cox1, despite earlier suggestions of a direct role in Cox1 biogenesis based on studies in S. cerevisiae . This protein serves as a checkpoint for proper Cox2 maturation, with its absence leading to increased turnover of Cox2.

How conserved is Cox16 function across fungal species?

While Cox16 is conserved across fungal species including S. cerevisiae and S. pombe, significant functional differences exist. Notably, human COX16 does not complement the yeast mutant strain, indicating evolutionary divergence in protein function . In S. cerevisiae, Cox16 was initially implicated directly in Cox1 biogenesis, whereas human studies show a predominant role in COX2 assembly. S. pombe Cox16 shares characteristics with both organisms but displays unique features adapted to its mitochondrial assembly pathways. Sequence comparison between yeast and human Cox16 reveals key differences, particularly in the N-terminal region where S. pombe Cox16, like human COX16, lacks the predictable presequence present in S. cerevisiae .

What phenotypic changes occur in S. pombe cells lacking functional Cox16?

S. pombe cells with Cox16 deficiency exhibit severely reduced cytochrome c oxidase activity, typically diminished to approximately 50-65% compared to wild-type cells . This reduction correlates with a significant decrease in the amount of fully assembled cytochrome c oxidase complex. Cox16 knockout cells show accumulation of Cox1 predominantly in MITRAC assembly intermediate complexes rather than in mature cytochrome c oxidase. The respiratory chain supercomplexes are also affected, with complex IV activity significantly reduced and a slight increase in complex I activity at the supercomplex level . These phenotypic changes highlight the essential role of Cox16 in proper cytochrome c oxidase assembly and function.

How does Cox16 mechanistically facilitate copper insertion into the Cu₁ site of Cox2?

Cox16 functions as a critical scaffold protein that coordinates the sequential binding of copper metallochaperones to newly synthesized Cox2. In S. pombe, Cox16 specifically promotes the recruitment of Sco1 (SCO1 homolog) to the Cox2 assembly module in a sequential manner that is essential for proper Cu₁ site formation . The interaction between Cox16 and these metallochaperones is highly specific and temporally regulated during the assembly process. Cox16 appears to preferentially interact with assembly intermediates rather than with fully assembled cytochrome c oxidase or respiratory chain supercomplexes, indicating its role is limited to the biogenesis process . The mechanistic model involves Cox16 binding to newly synthesized Cox2, promoting conformational changes that expose the copper-binding domain for effective metallation by Sco1 and related copper chaperones.

What are the molecular consequences of specific amino acid substitutions in Cox16 on protein-protein interactions within the assembly pathway?

Specific amino acid substitutions in Cox16 can significantly alter its interactions with metallochaperones and other assembly factors. By analyzing how pathogenic variants of interacting partners affect Cox16 binding, we can infer critical interaction domains. For example, pathogenic substitutions in SCO1 (G132S and P174L) drastically reduce association with COX16 while maintaining interaction with COX2 . This suggests that these residues in Sco1 are specifically required for Cox16 interaction but not for Cox2 binding. Similarly, mutations in COA6 (W59C and W66R) not only disrupt association with COX16 but also abolish interaction with COX2, indicating a different mechanism of pathogenicity . Such molecular insights can guide site-directed mutagenesis experiments in S. pombe Cox16 to identify critical residues required for specific protein interactions.

What is the role of post-translational modifications in regulating Cox16 function?

Post-translational modifications likely play significant roles in regulating Cox16 function during cytochrome c oxidase assembly, though specific modifications in S. pombe Cox16 remain underexplored. Based on homology with other assembly factors, potential modifications may include phosphorylation, acetylation, and redox-based modifications of cysteine residues that could sense the redox state of the mitochondria. Such modifications could regulate Cox16's ability to interact with partner proteins, its stability, or its subcellular localization. Investigating these modifications requires techniques such as mass spectrometry-based proteomics, site-directed mutagenesis of potential modification sites, and in vitro biochemical assays comparing wild-type and modified forms of the protein under various assembly conditions.

What are the optimal approaches for generating recombinant S. pombe Cox16 for structural and functional studies?

For structural and functional studies of S. pombe Cox16, several expression systems can be employed with specific optimization considerations:

  • Bacterial expression system:

    • Use E. coli strains optimized for membrane protein expression (C41, C43)

    • Fusion with solubility tags (MBP, SUMO, or TrxA)

    • Expression at lower temperatures (16-20°C) to improve folding

    • Inclusion of appropriate detergents for membrane protein solubilization

  • Yeast expression system:

    • S. cerevisiae or native S. pombe expression with appropriate selection markers

    • Use of inducible promoters (GAL1 for S. cerevisiae, nmt1 for S. pombe)

    • C-terminal tagging to preserve N-terminal targeting/topology

  • Insect cell expression:

    • Baculovirus expression system for higher eukaryotic post-translational modifications

    • Optimization of multiplicity of infection and harvest timing

For purification, a two-step approach combining affinity chromatography (using His6 or FLAG tags) followed by size exclusion chromatography in the presence of mild detergents (DDM, LMNG) has proven effective for membrane proteins similar to Cox16 . Proper folding should be verified through circular dichroism and functional assays examining interaction with partner proteins.

How can researchers effectively study the dynamic interactions between Cox16 and other assembly factors?

To study the dynamic interactions between Cox16 and other assembly factors, researchers can employ several complementary approaches:

  • BioID or APEX2 proximity labeling:

    • Generate Cox16 fusion constructs with biotin ligase or peroxidase

    • Identify transient interactors through spatially restricted biotinylation

    • Apply pulsed labeling to capture temporal dynamics

  • Quantitative immunoprecipitation:

    • Use SILAC or TMT labeling to quantify differential binding under various conditions

    • Perform IP of Cox16 after radiolabeling of mitochondrial translation products

    • Compare wild-type versus mutant backgrounds to identify context-dependent interactions

  • In vitro reconstitution assays:

    • Purify individual components and measure binding affinities

    • Use surface plasmon resonance or microscale thermophoresis for kinetic analyses

    • Reconstitute minimal assembly systems with purified components

  • Live-cell imaging:

    • Employ split fluorescent protein complementation to visualize interactions in real-time

    • Use FRET-based approaches to monitor proximity between proteins

These methodologies allow researchers to dissect not only the static "snapshots" of interactions but also the dynamic assembly process across different conditions and genetic backgrounds .

What approaches can be used to study the impact of Cox16 on mitochondrial copper homeostasis?

The study of Cox16's impact on mitochondrial copper homeostasis requires specialized techniques to measure copper distribution, binding, and utilization:

  • Trace metal analysis:

    • ICP-MS measurement of total and bioavailable copper in mitochondrial fractions

    • Comparison between wild-type and Cox16-deficient mitochondria

    • Subcellular fractionation to determine compartment-specific changes

  • Copper sensors and probes:

    • Genetically-encoded fluorescent copper sensors targeted to mitochondria

    • Ratiometric measurements of free vs. bound copper pools

    • Time-resolved measurements after copper supplementation or depletion

  • Radioactive copper tracking:

    • Use of 64Cu or 67Cu isotopes to track incorporation into Cox2

    • Pulse-chase experiments to monitor metallation kinetics

    • Autoradiography combined with BN-PAGE to visualize copper-loaded assembly intermediates

  • Copper chaperone interaction analysis:

    • Immunoprecipitation of Cox16 and copper chaperones under varying copper conditions

    • Analysis of copper-dependent conformational changes using limited proteolysis

    • Measurement of metallochaperone oxidation states in presence/absence of Cox16

These approaches can reveal whether Cox16 directly influences copper loading onto Cox2 or acts as a scaffold to position metallochaperones optimally.

How can researchers differentiate direct vs. indirect effects of Cox16 deficiency on cytochrome c oxidase assembly?

Differentiating direct from indirect effects of Cox16 deficiency requires careful experimental design and data interpretation:

ApproachDirect Effect IndicatorsIndirect Effect IndicatorsAnalysis Method
Temporal analysisImmediate changes following Cox16 depletionDelayed changes appearing graduallyTime-course experiments with inducible knockdown systems
Interaction mappingLost interactions involving Cox16Secondary loss of interactions between other componentsQuantitative proteomics comparing multiple purifications
Rescue experimentsPhenotypes rescued only by wild-type Cox16Phenotypes rescued by downstream factorsComplementation with Cox16 or downstream assembly factors
Intermediate accumulationSpecific accumulation of Cox16 substrate complexesGeneral destabilization of multiple assembly stepsBN-PAGE analysis with multiple assembly factor antibodies

When interpreting experimental data, researchers should look for specificity of effects. For example, in Cox16 knockout cells, the specific association of Cox2 with MITRAC12 or C12ORF62 is drastically affected, while other interactions may remain intact . This specificity suggests a direct role for Cox16 in facilitating Cox2 incorporation into Cox1-containing intermediates rather than a general destabilization of all assembly pathways.

What statistical approaches are most appropriate for analyzing Cox16-dependent changes in mitochondrial proteome and function?

For analyzing Cox16-dependent changes in the mitochondrial proteome and function, several statistical approaches are recommended:

  • For proteomics data:

    • ANOVA models with post-hoc corrections for multiple comparisons (Benjamini-Hochberg FDR)

    • LIMMA for differential expression analysis with moderation of variance estimates

    • Hierarchical clustering with bootstrap support to identify co-regulated proteins

    • Pathway enrichment analysis using GSEA or hypergeometric tests

  • For functional assays:

    • Repeated measures designs to account for batch effects

    • Non-parametric tests for activity measurements with non-normal distributions

    • Multiple regression models to identify predictors of enzymatic activity

    • Power analysis to determine appropriate sample sizes for detecting biologically relevant differences

  • For interaction studies:

    • Bayesian approaches to estimate interaction probabilities

    • Permutation tests to establish significance thresholds for protein interactions

    • Network analysis algorithms to identify modules and hubs affected by Cox16 loss

How can researchers reconcile contradictory findings about Cox16 function across different experimental systems?

Reconciling contradictory findings about Cox16 function across different experimental systems requires systematic comparative analysis:

  • System-specific differences:

    • Direct comparison of S. pombe, S. cerevisiae, and mammalian Cox16 in the same experimental system

    • Creation of chimeric proteins to identify domain-specific functions

    • Heterologous complementation experiments with controlled expression levels

  • Methodological variations:

    • Standardization of experimental conditions (detergents, buffer compositions)

    • Comparison of acute (siRNA/CRISPR) versus chronic (knockout) loss of function

    • Validation with multiple independent techniques for key findings

  • Contextual dependencies:

    • Analysis of genetic background effects (suppressor mutations)

    • Investigation of environmental influences (carbon source, oxygen tension)

    • Consideration of cell/tissue-specific factors in different systems

For example, the apparent discrepancy between reports implicating S. cerevisiae Cox16 in Cox1 biogenesis versus the clear role of human COX16 in COX2 assembly can be reconciled by recognizing that Cox16 acts at the interface of these two pathways, with varying emphasis depending on the organism . Additionally, the observation that human COX16 does not complement the yeast mutant strain underscores the importance of species-specific interactions that may have evolved differently .

What novel techniques could advance our understanding of Cox16 structure-function relationships?

Several emerging techniques hold promise for advancing our understanding of Cox16 structure-function relationships:

  • Cryo-electron microscopy:

    • High-resolution structural determination of Cox16 in different assembly intermediates

    • Visualization of conformational changes during the assembly process

    • Integration with crosslinking mass spectrometry to identify interaction interfaces

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics

    • Optical tweezers to study force-dependent interactions

    • Single-molecule tracking in mitochondrial membranes

  • Advanced genetic approaches:

    • CRISPR base editing for precise amino acid substitutions

    • Synthetic genetic array analysis to map genetic interactions

    • Deep mutational scanning to comprehensively assess functional domains

  • In organello translation systems:

    • Reconstituted translation systems with purified mitochondrial ribosomes

    • Real-time monitoring of assembly intermediate formation

    • Manipulation of assembly factors during ongoing synthesis

These techniques would allow researchers to move beyond correlative observations to mechanistic understanding of how Cox16 structure dictates its function in orchestrating cytochrome c oxidase assembly .

How might insights from Cox16 research inform therapeutic approaches for mitochondrial disorders?

Insights from Cox16 research have several potential applications for developing therapeutic approaches for mitochondrial disorders:

  • Gene therapy opportunities:

    • Development of gene replacement therapies for Cox16-related mitochondrial diseases

    • Design of optimized Cox16 versions with enhanced assembly capacity

    • Use of Cox16 overexpression to compensate for defects in interacting partners

  • Small molecule interventions:

    • Screening for compounds that stabilize Cox16-dependent interactions

    • Development of copper delivery agents that bypass Cox16-dependent pathways

    • Design of proteostasis modulators that enhance assembly intermediate stability

  • Biomarker development:

    • Identification of Cox16-dependent assembly intermediates as diagnostic markers

    • Monitoring of Cox16 function as a predictor of therapeutic efficacy

    • Personalized medicine approaches based on specific assembly defects

  • Broader therapeutic principles:

    • Understanding bypass mechanisms that can compensate for assembly defects

    • Identification of rate-limiting steps that could be targeted across multiple disorders

    • Development of mitochondrial stress response modulators that enhance adaptation to assembly defects

Research on pathogenic mutations in SCO1 and COA6 that affect interaction with Cox16 already provides a framework for understanding how subtle molecular defects can lead to diverse clinical presentations . These insights could guide precision medicine approaches for mitochondrial diseases.

What are the most promising directions for studying the evolutionary diversification of Cox16 function?

The evolutionary diversification of Cox16 function represents a fascinating area for future research, with several promising directions:

  • Comparative genomics and proteomics:

    • Systematic comparison of Cox16 sequences and interactomes across diverse eukaryotic lineages

    • Correlation of Cox16 sequence features with mitochondrial genetic code variations

    • Identification of lineage-specific adaptations in assembly pathways

  • Ancestral sequence reconstruction:

    • Resurrection of inferred ancestral Cox16 proteins to test functional capabilities

    • Characterization of evolutionary trajectories leading to functional specialization

    • Identification of key mutations that altered interaction specificity

  • Horizontal gene transfer analysis:

    • Investigation of potential horizontal transfer events affecting Cox16 evolution

    • Comparison of nuclear-encoded versus mitochondrially-encoded assembly systems

    • Assessment of co-evolution between Cox16 and its interaction partners

  • Adaptation to environmental niches:

    • Study of Cox16 function in organisms adapted to extreme environments

    • Analysis of oxygen-dependent regulation of assembly pathways

    • Investigation of metabolic adaptations influencing cytochrome c oxidase assembly

The observation that human COX16 cannot complement the yeast Cox16 function highlights the significant evolutionary divergence in this protein family . Understanding how these differences arose and their functional consequences could provide insights into the fundamental principles governing the evolution of molecular machines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.