Recombinant Schizosaccharomyces pombe Cytochrome c oxidase subunit 2 (cox2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cox2; SPMIT.11; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cox2
Target Protein Sequence
MLFFNSILNDAPSSWALYFQDGASPSYLGVTHLNDYLMFYLTFIFIGVIYAICKAVIEYN YNSHPIAAKYTTHGSIVEFIWTLIPALILILVALPSFKLLYLLDEVQKPSMTVKAIGRQW FWTYELNDFVTNENEPVSFDSYMVPEEDLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDV IHSWAVPSLGIKCDCIPGRLNQVSLSIDREGLFYGQCSELCGVLHSSMPIVVQGVSLEDF LAWLEENS
Uniprot No.

Target Background

Function
Recombinant *Schizosaccharomyces pombe* Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes (Complex II, III, and IV) that facilitate electron transfer from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in this process, specifically within Complex IV where it participates in the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1, consisting of heme a3 and CuB. The BNC catalyzes the four-electron reduction of oxygen to two water molecules, utilizing electrons from cytochrome c and protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of cox2 in Schizosaccharomyces pombe?

Cox2 is a mitochondrially-encoded subunit of cytochrome c oxidase (Complex IV) in the respiratory chain of S. pombe. This protein functions as a key component of the final O₂-reducing complex that receives electrons from soluble cytochrome c and transfers them through Cu₁ and then to the catalytic site where oxygen reduction occurs. The protein plays a critical role in cellular energy conversion through the electron transport chain located in the inner mitochondrial membrane . Unlike some other fungal species, the S. pombe cox2 gene contains a large group II intron in several strains, which can be folded into a typical group II intron secondary structure with the expected sequence motifs for subgroup IIA1 .

How does S. pombe cox2 compare to homologous proteins in other species?

S. pombe cox2 shows significant evolutionary conservation but with notable differences from other species:

Speciescox2 Gene StructureIntron PresenceUnique Features
S. pombeContains large group II intron in some strains2436 nucleotides in several strainsFive nucleotide changes at 3'-exon sequence compared to reference strain
S. cerevisiaeNo homologous group II intronDifferent intron patternRequires specific translational activator Pet111
Higher plantsUnrelated intronInserted at same location as S. pombeDifferent evolutionary origin
S. octosporusSimilar gene organizationDifferent intron patternPart of comparison in mitochondrial genome evolution studies

The cox2 gene in S. pombe shows a mosaic structure, with five nucleotide changes observed at the 3'-exon sequence compared to the reference strain 50, one of which occurs at the splice point leading to an amino acid change from threonine to serine . This structure provides valuable insights into evolutionary processes in mitochondrial genomes.

What are the key components of the mitochondrial respiratory chain in S. pombe and where does cox2 fit in?

The S. pombe mitochondrial respiratory chain consists of several complexes that work together for cellular energy conversion:

  • Complex I (NADH dehydrogenase)

  • Complex II (Succinate dehydrogenase)

  • Complex III (Cytochrome bc₁ complex) containing Cob1 (apocytochrome b)

  • Complex IV (Cytochrome c oxidase) containing Cox1, Cox2, and Cox3 subunits

  • Complex V (ATP synthase) containing Atp6, Atp8, and Atp9 subunits

What are the unique features of the cox2 gene structure in S. pombe?

The cox2 gene in S. pombe has several distinctive structural features:

  • In multiple S. pombe strains, the gene contains a large group II intron spanning 2436 nucleotides

  • The intron can be folded into a typical group II intron secondary structure with all expected sequence motifs for subgroup IIA1

  • Five nucleotide changes occur in the 3'-exon sequence compared to the reference strain 50

  • One of these changes occurs at the splice point leading to a serine instead of threonine in the cox2 polypeptide

  • All alterations result in the replacement of frequently used codons by rare ones

  • The intron has unusual sequence motifs thought necessary for interaction between the 5'-exon and intron during splicing (the EBS1/IBS1 and EBS2/IBS2 pairings)

  • The intron is inserted at the same location as an otherwise unrelated intron found in higher plants

These structural peculiarities make the cox2 gene in S. pombe particularly interesting for studying RNA splicing mechanisms and the evolution of mitochondrial genes.

How is mitochondrial translation of cox2 regulated in S. pombe compared to S. cerevisiae?

Mitochondrial translation regulation shows significant differences between S. pombe and S. cerevisiae:

AspectS. pombeS. cerevisiae
Translation activatorsFewer mRNA-specific activatorsFifteen mRNA-specific translational activators
cox2 translationNo specific translational activator identifiedRequires Pet111 for translation
Conserved factorsCbp3, Cbp6, Mss51 homologs presentCbp3, Cbp6, Mss51 serve dual roles
Functional rolePost-translational functions predominateBoth translational and post-translational functions
PPR proteinsPpr1 required for cox2 mRNA stabilityDifferent set of PPR proteins

In S. pombe, homologs of S. cerevisiae translational activators (Cbp3, Cbp6, and Mss51) are not required for the translation of mitochondrial mRNAs but fulfill post-translational functions related to the assembly of respiratory complexes III and IV . This suggests a significant evolutionary divergence in mitochondrial translation regulation between these two yeast species. Additionally, the PPR protein Ppr1 in S. pombe is specifically required for the stability of both cox2 and cox3 mRNAs, indicating a different regulatory mechanism .

What role do PPR proteins play in cox2 expression in S. pombe?

Pentatricopeptide repeat (PPR) proteins play crucial roles in mitochondrial gene expression in S. pombe, particularly for cox2:

The mechanism of action of these PPR proteins involves binding to specific RNA sequences, likely through their PPR motifs, to protect mRNAs from degradation or promote their translation. The PPR protein system in S. pombe represents a different regulatory approach compared to S. cerevisiae, highlighting evolutionary divergence in mitochondrial gene expression regulation .

What are the optimal methods for expressing recombinant S. pombe cox2 for structural studies?

For structural studies of recombinant S. pombe cox2, researchers have successfully employed the following methodological approach:

  • Expression System Selection:

    • For in vivo studies: Use endogenous expression with a C-terminal tag

    • For cryo-EM studies: Combine with affinity purification methods

  • Purification Strategy:

    • Employ affinity purification using a tagged version of cox2 or another complex IV subunit

    • Use a tandem affinity purification (TAP) tag approach for higher purity

  • Structural Analysis Protocol:
    Researchers have successfully used cryo-EM to determine the structure of S. pombe Complex IV with bound protein partners. This approach revealed eleven subunits and a bound hypoxia-induced gene 1 (Hig1) domain of respiratory supercomplex factor 2 (Rcf2) .

For optimal results, combine cryo-EM with spectroscopic techniques (like UV-visible spectroscopy) to correlate structural information with functional data. This has allowed researchers to determine that the reaction sequence of reduced enzyme with O₂ proceeds over a timeframe of μs-ms, similar to mammalian CIV .

How can researchers effectively study the splicing mechanism of the cox2 intron in S. pombe?

To study the splicing mechanism of the cox2 intron in S. pombe, researchers should employ a multi-faceted approach:

  • RNA Isolation and Analysis:

    • Extract total RNAs using the hot phenol protocol from cells grown to exponential phase

    • Run RNAs on formaldehyde gels before transfer onto appropriate membranes

    • Perform Northern blot analyses with probes hybridized at 65°C under standard saline conditions

    • For detection of spliced and unspliced forms, design probes spanning exon-exon junctions (for spliced) and intron-exon junctions (for unspliced)

  • In vivo Splicing Assessment:

    • Use S. pombe strains with different genetic backgrounds to assess the effect of mutations on splicing efficiency

    • Analyze the unusual EBS1/IBS1 and EBS2/IBS2 pairings through site-directed mutagenesis and assess the impact on splicing

  • Protein Expression Analysis:

    • Grow S. pombe cells to early exponential phase in complete medium containing appropriate carbon sources

    • Label mitochondrial proteins using ³⁵S methionine and cysteine in the presence of cycloheximide to block cytoplasmic translation

    • For pulse-chase experiments, label cells in vivo to track the processing of the cox2 precursor to mature form

This combined approach allows researchers to effectively study both the RNA splicing mechanism and the downstream consequences on protein expression, providing a comprehensive understanding of the cox2 intron processing in S. pombe.

What approaches are recommended for studying mitochondrial protein synthesis of cox2 in S. pombe?

For studying mitochondrial protein synthesis of cox2 in S. pombe, researchers should consider these methodological approaches:

  • In vivo Labeling of Mitochondrial Translation Products:

    • Grow S. pombe cells to early exponential phase in complete medium with 5% raffinose containing 0.1% glucose

    • Label mitochondrial proteins by incubating whole cells with ³⁵S methionine and cysteine at 30°C for 3 hours

    • Use cycloheximide (10mg/ml) to specifically block cytoplasmic translation

    • For pulse-chase experiments, label cells in vivo followed by a chase with unlabeled amino acids

  • Analysis of Translation Using Deletion Mutants:

    • Generate knockout strains for suspected translation factors (e.g., Ppr10, Mpa1) using the one-step gene replacement method

    • Verify deletions by PCR and loss of expression by qRT-PCR

    • Compare protein synthesis patterns in wild-type and deletion strains to identify factors specifically involved in cox2 translation

  • Protein-RNA Interaction Studies:

    • Create strains carrying epitope-tagged versions of potential regulatory proteins

    • Use tandem affinity purification (TAP) methods to isolate protein complexes

    • Analyze co-purified RNAs to identify direct interactions with cox2 mRNA

    • Perform RNA immunoprecipitation followed by RT-PCR to detect specific associations

  • Assessing the Role of Specific Factors:

    • Express wild-type and mutant versions of regulatory factors using thiamine-repressible promoters (e.g., nmt1)

    • Monitor the effects on cox2 synthesis through complementation studies in deletion strains

    • Use FLAG-tagged constructs for immunoprecipitation studies to identify interaction partners

These approaches provide complementary data on the mechanisms of cox2 translation in S. pombe and help identify the specific factors involved in this process.

How does oxidative stress impact cox2 expression and Complex IV assembly in S. pombe?

Oxidative stress significantly impacts mitochondrial gene expression in S. pombe, including cox2, through several mechanisms:

  • Transcriptional Responses:
    Oxidative stress induces a complex transcriptional response that varies depending on H₂O₂ concentration. At high doses (20 mM H₂O₂), phosphorylation of Spc1 and its target Atf1 increases, strongly influencing the transcriptional response, while at mild doses (0.5 mM H₂O₂), different transcription factors play more prominent roles .

  • Dose-Dependent Effects on Gene Expression:
    The transcriptional response to oxidative stress in S. pombe shows dose-dependent variations. Studies have shown differences in gene expression patterns between cells treated with 20 mM versus 0.5 mM H₂O₂, with different Core Environmental Stress Response (CESR) gene expression patterns .

  • Impact on Mitochondrial Assembly:
    Oxidative stress can affect the assembly of respiratory complexes, including Complex IV, by:

    • Damaging mitochondrial proteins through oxidative modification

    • Affecting the import of nuclear-encoded subunits

    • Altering the stability of mitochondrially-encoded components like cox2

    • Influencing the activity of assembly factors

  • Research Approaches to Study These Effects:
    Researchers can investigate the impact of oxidative stress on cox2 and Complex IV using:

    • Differential gene expression studies with H₂O₂ treatment

    • ROS measurement using indicators like H₂-DCFDA and flow cytometry

    • Analysis of stress response mutants (e.g., Δwee1) to understand regulatory pathways

    • Protein phosphorylation studies to track the activation of stress-response pathways

This research area provides important insights into how environmental stressors influence mitochondrial function and respiratory chain assembly in S. pombe, with potential implications for understanding similar processes in higher eukaryotes.

What is known about the interaction between cox2 and other protein factors in Complex IV assembly?

Complex IV assembly in S. pombe involves sophisticated interactions between cox2 and various protein factors:

  • Respiratory Supercomplex Factors:
    Cryo-EM studies have revealed that Complex IV in S. pombe includes eleven subunits and can bind the hypoxia-induced gene 1 (Hig1) domain of respiratory supercomplex factor 2 (Rcf2). This binding does not require the presence of a CIII-CIV supercomplex, suggesting Rcf2 is a component of CIV itself. AlphaFold-Multimer models suggest that Hig1 domains of both Rcf1 and Rcf2 bind at the same site on CIV, indicating mutually exclusive binding .

  • Translational and Assembly Factors:
    Unlike in S. cerevisiae, where specific translational activators like Pet111 are required for cox2 translation, S. pombe homologs of factors like Cbp3, Cbp6, and Mss51 are not required for translation but fulfill post-translational functions in complex assembly .

  • PPR Proteins:
    Several PPR proteins in S. pombe influence cox2 expression and assembly:

    • Ppr1 is required for the stability of both cox2 and cox3 mRNAs

    • Ppr10 plays a general role in mitochondrial protein synthesis

    • Ppr10 interacts with Mpa1 in vivo and in vitro, with both proteins colocalizing in the mitochondrial matrix

  • Mitochondrial Matrix Proteases:
    Lon1 protease in S. pombe may process mitochondrial proteins, including those involved in Complex IV assembly. Research shows that Mpa1 (associated with Ppr10) stabilizes mitochondrial translation products by antagonizing the activity of the Lon1 protease .

These complex interactions ensure proper assembly of functional Complex IV, with cox2 correctly positioned within the complex. Understanding these interactions is crucial for comprehending respiratory chain assembly and function in eukaryotic cells.

How do mutations in S. pombe cox2 affect respiratory chain function and cellular metabolism?

Mutations in S. pombe cox2 have profound effects on respiratory chain function and cellular metabolism:

  • Respiratory Competence:

    • Unlike S. cerevisiae, S. pombe is petite-negative, meaning it cannot survive without functional mitochondrial respiration

    • Mutations in cox2 that impair Complex IV assembly or function therefore directly affect cell viability, particularly during respiratory growth conditions and late-stationary phase

    • Mutants show growth defects in respiratory media, highlighting the essential role of functional cox2

  • Metabolic Adaptations:
    When cox2 function is compromised, cells must adapt their metabolism in several ways:

    • Increased dependence on fermentative metabolism

    • Altered mitochondrial gene expression, often showing compensatory upregulation of other respiratory components

    • Changes in nuclear gene expression to accommodate metabolic shifts

    • Modified mitochondrial dynamics and autophagy to manage dysfunctional mitochondria

  • Specific Effects of Different Mutation Types:

    Mutation TypeEffect on ProteinCellular Consequence
    Splice site mutationsAltered splicing, potential frameshiftSeverely impaired Complex IV assembly
    Codon substitutionsAmino acid changes, particularly at functional sitesVariable effects from mild to severe depending on location
    Nucleotide changes in regulatory regionsAltered expression levelsQuantitative reduction in Complex IV
    Intronic mutations affecting RNA processingDecreased mature mRNAReduced cox2 protein levels
  • Research Approaches:
    To study these effects, researchers employ:

    • In vivo labeling of mitochondrial translation products to detect changes in cox2 synthesis

    • Spectroscopic techniques to measure enzyme activity and reaction kinetics

    • Growth analyses under different carbon sources to assess respiratory capacity

    • Genetic complementation studies to confirm the causality of specific mutations

These studies provide critical insights into the role of cox2 in cellular respiration and the consequences of its dysfunction, which are relevant to understanding mitochondrial diseases in higher eukaryotes.

How does S. pombe cox2 differ from that in other yeast species, and what does this reveal about evolutionary processes?

Comparative analysis of cox2 across yeast species reveals significant evolutionary insights:

  • Structural Differences:

    SpeciesIntron StructureCoding Sequence FeaturesGenomic Context
    S. pombeLarge group II intron (2436 nt) in some strainsFive nucleotide changes at 3'-exon in intron-containing strainsPart of a compact mtDNA (~19.4 kb)
    S. cerevisiaeDifferent intron patternRequires specific translational activator (Pet111)Different organization in mtDNA
    S. octosporusDifferent intron profilePart of larger mtDNA (44,227 bp)Different non-coding regions
    S. japonicusDifferent intron profilePart of much larger mtDNA (>80 kb)Expanded non-coding regions
  • Evolutionary Implications:

    • The size variation of mitochondrial DNA across Schizosaccharomyces species (S. pombe: 19,431 bp, S. octosporus: 44,227 bp, S. japonicus: >80 kb) is primarily due to non-coding regions, suggesting different evolutionary pressures on genome compaction

    • The insertion of the cox2 intron at the same location as unrelated introns in higher plants suggests potential "hotspots" for intron insertion in evolution

    • The mosaic structure of cox2 in S. pombe, with specific nucleotide changes, suggests mechanisms of genetic drift or selection acting on this gene

  • Functional Conservation and Divergence:

    • Despite structural differences, the core function of cox2 in the respiratory chain is conserved across species

    • Translational regulation has diverged significantly, with S. pombe lacking many of the mRNA-specific translational activators present in S. cerevisiae

    • Post-translational assembly processes show greater conservation than translational regulation mechanisms, suggesting stronger evolutionary constraints on the assembly process

These comparative analyses provide valuable insights into the evolutionary processes shaping mitochondrial genes and their expression regulation, highlighting both conserved features essential for respiratory function and divergent elements reflecting adaptation to different ecological niches.

What insights can population genomics provide about natural variation in S. pombe cox2?

Population genomics studies of S. pombe provide valuable insights into natural variation of cox2:

  • Genetic Diversity Patterns:
    Analysis of 57 genetic varieties from 161 natural isolates of S. pombe collected worldwide reveals significant diversity patterns. The genome of S. pombe (approximately 12.8Mb across three chromosomes plus the mitochondrial genome) shows variable levels of polymorphism across regions, with some areas under selective constraint showing lower nucleotide diversity than expected .

  • Selective Pressures:

    • Intergenic regions, introns, and UTRs show lower levels of nucleotide diversity than synonymous sites, suggesting functional constraints

    • Several genomic regions show reduced nucleotide diversity, potentially due to selective sweeps

    • Regions with high divergence between strain subgroups might indicate reproductive isolation mechanisms or strong positive selection

  • Specific cox2 Variations:
    While detailed cox2-specific variation data is limited in the provided materials, population genomics approaches can reveal:

    • The distribution of the large group II intron across different S. pombe strains

    • Selection pressures acting specifically on the cox2 gene compared to other mitochondrial genes

    • Correlation between cox2 variants and ecological factors or geographical distribution

  • Research Applications:
    Researchers can leverage population genomics to study cox2 variation by:

    • Analyzing whole-genome resequencing data from diverse S. pombe strains

    • Using comparative genomics to identify conserved and variable regions within cox2

    • Correlating genetic variants with functional differences in respiratory capacity

    • Investigating potential co-evolution between mitochondrial and nuclear genes affecting Complex IV

Population genomics approaches provide a powerful framework for understanding how natural variation in cox2 has been shaped by evolutionary forces, offering insights into both fundamental evolutionary processes and potential functional implications of genetic diversity in this essential respiratory chain component.

How can researchers use transcription factor mapping in S. pombe to understand regulatory networks affecting mitochondrial genes like cox2?

Researchers can leverage transcription factor (TF) mapping in S. pombe to uncover regulatory networks affecting mitochondrial genes including cox2:

  • Comprehensive TF Libraries and Mapping:
    Recent research has created a comprehensive library of 89 endogenously tagged S. pombe TFs, mapping their protein and chromatin interactions through immunoprecipitation-mass spectrometry and chromatin immunoprecipitation sequencing. This approach identified protein interactors for half the TFs, with over a quarter potentially forming stable complexes .

  • Regulatory Network Insights:
    This mapping revealed DNA binding sites across 2,027 unique genomic regions, uncovering motifs for 38 TFs and revealing a complex regulatory network with extensive TF cross- and autoregulation. Such networks can include factors that regulate nuclear genes encoding:

    • Mitochondrial transcription factors

    • Proteins involved in mitochondrial translation

    • Assembly factors for respiratory complexes

    • Proteins responding to mitochondrial dysfunction

  • Methodological Approach for Mitochondrial Gene Regulation:
    Researchers studying mitochondrial gene regulation should:

    • Examine TF binding to nuclear genes encoding mitochondrial proteins

    • Identify TFs responding to mitochondrial dysfunction

    • Analyze stress-responsive TFs that coordinate nuclear-mitochondrial communication

    • Investigate TF families with diverse DNA binding patterns but conserved sequence preferences

  • Specific Applications to cox2 Regulation:
    While cox2 is mitochondrially encoded, its expression is influenced by nuclear-encoded factors through:

    • Mitochondrial transcription machinery regulation

    • Factors affecting RNA processing and stability (like PPR proteins)

    • Translational activators and assembly factors

    • Retrograde signaling pathways communicating mitochondrial status to the nucleus

  • Integration with Other Data Types:
    For maximum insight, researchers should integrate TF mapping with:

    • Transcriptomics data under different respiratory conditions

    • Metabolomics to correlate with energetic status

    • Proteomics to track effects on protein abundance

    • Genetic interaction screens to identify functional relationships

This comprehensive approach to understanding transcriptional regulatory networks provides a powerful framework for elucidating how S. pombe coordinates nuclear and mitochondrial gene expression, particularly for essential components like cox2 that are central to cellular respiration.

How can recombinant S. pombe cox2 be used as a model for studying human mitochondrial diseases?

S. pombe provides an excellent model for studying human mitochondrial diseases related to Complex IV dysfunction:

  • Evolutionary Conservation and Advantages:
    S. pombe resembles human cells in several key aspects that make it valuable for mitochondrial disease research:

    • Mitochondrial inheritance patterns

    • Mitochondrial transport mechanisms

    • Sugar metabolism pathways

    • Mitogenome structure

    • Petite-negative phenotype (dependence on functional mitochondria for viability)

    • Similar transcription mechanisms producing polycistronic transcripts processed via the tRNA punctuation model

    • Conserved machinery for mitochondrial gene expression

  • Methodological Framework:
    Researchers can develop models for human mitochondrial diseases by:

    • Creating S. pombe strains with mutations corresponding to human pathogenic variants

    • Using CRISPR/Cas9 or traditional homologous recombination to introduce precise mutations

    • Employing the various mitotic recombination assays developed in S. pombe to study DNA damage repair mechanisms

    • Utilizing the powerful experimental techniques available for S. pombe, including genetic manipulation methods and mitochondrial protein labeling approaches

  • Specific Applications for cox2-Related Disorders:
    For studying human diseases related to COX2 dysfunction:

    • Introduce equivalent mutations to those found in human patients

    • Analyze effects on complex assembly, stability, and function

    • Test potential therapeutic approaches by suppressor screening

    • Study nuclear-mitochondrial communication in response to dysfunction

  • Advantages Over Other Model Systems:
    S. pombe offers several advantages compared to other model systems:

    • Unlike S. cerevisiae, it cannot survive without functional mitochondria, better reflecting human cells

    • More tractable than mammalian cell culture for genetic manipulation

    • Faster generation time than mammalian models

    • Well-characterized genome and extensive genetic tools

    • Ability to perform large-scale genetic screens

This approach allows researchers to leverage the experimental advantages of S. pombe while studying processes relevant to human mitochondrial disease, potentially accelerating the development of therapeutic approaches for these often devastating disorders.

What emerging technologies are most promising for advancing our understanding of recombinant S. pombe cox2?

Several cutting-edge technologies show significant promise for advancing our understanding of recombinant S. pombe cox2:

  • Advanced Structural Biology Approaches:

    • Cryo-Electron Microscopy: Already successfully applied to determine the structure of S. pombe Complex IV with bound protein partners, revealing eleven subunits and a bound Hig1 domain of Rcf2 . Future advancements in resolution and sample preparation could provide even more detailed insights into cox2 interactions.

    • Integrative Structural Biology: Combining cryo-EM with other structural techniques like X-ray crystallography, NMR, and computational approaches (e.g., AlphaFold-Multimer models) to generate comprehensive structural models of cox2 within Complex IV .

  • Advanced Genomics and Systems Biology:

    • Long-read Sequencing Technologies: Enable better characterization of mitochondrial genome structure, including accurate sequencing of the complex cox2 intron structure.

    • Single-Cell Approaches: Allow investigation of cell-to-cell variability in mitochondrial gene expression and function, particularly relevant for understanding heteroplasmy-like phenomena.

    • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics to understand the system-level effects of cox2 variations or mutations.

  • Real-time Imaging and Functional Analysis:

    • Live-Cell Imaging: Advanced microscopy techniques to visualize mitochondrial dynamics and protein movements in living cells.

    • Biosensors: Development of specific sensors for monitoring Complex IV activity, electron transfer, or oxygen consumption in real-time.

    • High-throughput Functional Assays: Methods for rapid assessment of respiratory function in multiple mutant strains.

  • Gene Editing and Synthetic Biology:

    • CRISPR/Cas Systems: Refining gene editing approaches for precise modification of mitochondrial genes in S. pombe.

    • Synthetic Mitochondrial Genomes: Creating designer mitochondrial genomes to test hypotheses about cox2 function and regulation.

    • Orthogonal Translation Systems: Developing systems for controlled expression of modified cox2 variants.

These emerging technologies, when applied to S. pombe cox2 research, promise to deepen our understanding of mitochondrial gene expression, respiratory complex assembly, and the fundamental processes of cellular respiration, with potential applications in both basic research and biomedical contexts.

What are the most significant unresolved questions about S. pombe cox2 that warrant further investigation?

Despite extensive research, several crucial questions about S. pombe cox2 remain unresolved and merit further investigation:

  • Evolutionary and Structural Questions:

    • What evolutionary pressures led to the acquisition of the large group II intron in some S. pombe strains but not others?

    • Why does the cox2 intron show unusual sequence motifs for splice site recognition, and how does this affect splicing efficiency?

    • What is the functional significance of the amino acid change (threonine to serine) resulting from the splice point mutation in intron-containing strains?

    • How does the structure of S. pombe cox2 within Complex IV compare with other species at the atomic level?

  • Regulatory Mechanism Questions:

    • What specific factors regulate cox2 transcript stability and processing?

    • How do PPR proteins like Ppr1 recognize and stabilize cox2 mRNA at the molecular level?

    • What coordinates the expression of mitochondrial-encoded cox2 with nuclear-encoded Complex IV subunits?

    • How do cells adjust cox2 expression in response to different metabolic conditions or stressors?

  • Assembly and Function Questions:

    • What is the precise sequence of events in cox2 incorporation into Complex IV?

    • How do Rcf1 and Rcf2 differentially interact with cox2 and affect Complex IV function?

    • What determines whether Rcf1 or Rcf2 binds to Complex IV, given their apparently mutually exclusive binding?

    • How do post-translational modifications affect cox2 function within Complex IV?

  • Translational Regulation Questions:

    • Given that S. pombe lacks many of the mRNA-specific translational activators found in S. cerevisiae, what mechanisms regulate cox2 translation?

    • How does the translation machinery recognize the cox2 transcript without dedicated translational activators?

    • What role do general translational factors like Ppr10 and its associated protein Mpa1 play in cox2 synthesis?

    • How is translation coupled to assembly into Complex IV?

  • Population Genetic Questions:

    • What is the worldwide distribution of different cox2 variants, particularly the intron-containing versus intron-less forms?

    • Do specific ecological niches correlate with particular cox2 variants?

    • What selective pressures act on cox2 in natural populations of S. pombe?

Addressing these questions will require integrated approaches combining structural biology, genetics, biochemistry, and evolutionary analyses. Such investigations promise to expand our understanding not only of S. pombe mitochondrial function but also of fundamental processes in eukaryotic mitochondrial gene expression and respiratory chain assembly.

What are the key considerations for designing experiments to study S. pombe cox2 expression and function?

When designing experiments to study S. pombe cox2 expression and function, researchers should consider these critical factors:

  • Strain Selection and Verification:

    • Choose appropriate strain backgrounds based on research questions (intron-containing vs. intron-less strains)

    • Verify strains by PCR and sequencing of the cox2 region before experiments

    • Consider the extensive natural variation in S. pombe (57 genetic varieties identified among 161 isolates)

    • Use isogenic controls for all experiments to avoid confounding factors

  • Growth Conditions and Media Selection:

    • Carbon source selection is crucial, as S. pombe is petite-negative and requires functional mitochondria

    • Consider pre-adaptation periods when switching between fermentable and non-fermentable carbon sources

  • RNA Analysis Considerations:

    • For cox2 transcript analysis, extract total RNAs using hot phenol protocol from cells in appropriate growth phase

    • For Northern blot analyses, hybridize at 65°C under standard saline conditions

    • Design probes to distinguish between unspliced precursors and mature cox2 mRNA

    • Consider the use of 5' RACE to identify precise transcript ends

  • Protein Synthesis and Analysis:

    • For in vivo labeling of mitochondrial translation products:

      • Grow cells to early exponential phase in complete medium with appropriate carbon source

      • Use cycloheximide (10mg/ml) to specifically block cytoplasmic translation

      • Label with ³⁵S methionine and cysteine for 3 hours at 30°C

    • For pulse-chase experiments, carefully optimize chase times to capture the kinetics of cox2 processing

  • Functional Assays:

    • Combine multiple approaches to assess respiratory function:

      • Growth rate measurements in respiratory media

      • Oxygen consumption assays

      • Complex IV activity measurements

      • Spectroscopic techniques to study the reaction sequence with O₂

  • Genetic Manipulation Strategies:

    • For gene deletions, use the one-step gene replacement method

    • Verify deletions by PCR and loss of expression by qRT-PCR

    • For epitope tagging, carefully select tag position to minimize functional interference

    • Use thiamine-repressible promoters (e.g., nmt1) for controlled expression of regulatory factors

These methodological considerations ensure reliable and reproducible results when studying S. pombe cox2, facilitating meaningful comparisons across different studies and experimental conditions.

How can researchers troubleshoot common challenges in S. pombe mitochondrial studies?

Researchers frequently encounter challenges when working with S. pombe mitochondria. Here are solutions to common problems:

  • Poor Mitochondrial Isolation Yields:

    ChallengeTroubleshooting Approach
    Insufficient cell disruptionOptimize cell wall digestion with Zymolyase; consider mechanical disruption methods
    Mitochondrial fragmentationUse gentler homogenization; maintain samples at 4°C throughout processing
    Low mitochondrial contentGrow cells in respiratory medium before isolation; harvest at optimal density (~1 OD₆₀₀)
    Contaminants in preparationUse additional purification steps like sucrose gradient centrifugation
  • Difficulties in Detecting Mitochondrial Translation Products:

    • Problem: Weak signal in in vivo labeling experiments

    • Solutions:

      • Increase labeling time from standard 3 hours to 4-5 hours

      • Optimize cycloheximide concentration for complete cytoplasmic translation inhibition

      • Use fresh ³⁵S methionine/cysteine with high specific activity

      • Concentrate samples prior to gel loading

      • For mitochondrially-encoded proteins like cox2, mitotracker staining can help verify mitochondrial integrity

  • Inconsistent RNA Extraction Results:

    • Problem: Degraded or variable RNA yields

    • Solutions:

      • Use RNase-free reagents and DEPC-treated solutions

      • Extract RNA from cells at consistent growth phases

      • Add RNAlater Stabilization Solution immediately after harvesting

      • For Northern blots, increase hybridization time for difficult-to-detect transcripts

      • Consider increasing exposure time (up to 2 weeks for low-abundance transcripts)

  • Challenges with Genetic Manipulations:

    • Problem: Low transformation efficiency or incorrect integration

    • Solutions:

      • For gene deletions, ensure 5' and 3' flanks are of sufficient length (>500bp recommended)

      • Verify all deletions by both PCR and expression analysis (qRT-PCR)

      • For epitope tagging, confirm integration at correct locus and check expression levels

      • When creating double deletion mutants, verify each deletion separately

  • Interpreting Respiratory Phenotypes:

    • Problem: Complex or subtle phenotypes

    • Solutions:

      • Compare growth under multiple conditions (glucose, glycerol, minimal vs. rich media)

      • Measure growth curves rather than endpoint measurements

      • Assess late-stationary phase viability, where respiratory defects are often more pronounced

      • Combine growth assays with direct measurements of oxygen consumption or Complex IV activity

By applying these troubleshooting approaches, researchers can overcome common technical challenges in S. pombe mitochondrial studies, ensuring more reliable and interpretable results in cox2 research.

What are the best practices for data analysis and interpretation in S. pombe cox2 research?

To ensure robust data analysis and interpretation in S. pombe cox2 research, follow these best practices:

  • Experimental Design for Statistical Validity:

    • Include sufficient biological replicates (minimum n=3) for all experiments

    • Process samples in duplicate or triplicate for technical replication

    • Include proper controls for each experiment type:

      • Wild-type strain alongside mutants

      • Empty vector controls for expression constructs

      • Mock treatments for stress conditions

      • Isogenic controls for genetic manipulations

  • Quantitative Analysis Approaches:

    • For RNA analysis:

      • Normalize transcript levels to stable reference genes (e.g., act1, cdc2)

      • Use multiple normalization methods to confirm findings

      • For complex transcript patterns (e.g., spliced vs. unspliced), calculate and report ratios

    • For protein analysis:

      • Quantify band intensities using appropriate software

      • Report relative rather than absolute values

      • Include loading controls and housekeeping proteins

      • For in vivo labeling experiments, normalize to total incorporation or to other mitochondrial translation products

  • Statistical Analysis Guidelines:

    • Apply appropriate statistical tests based on data distribution and experimental design

    • Report p-values and confidence intervals

    • For multiple comparisons, apply appropriate corrections (e.g., Bonferroni, FDR)

    • Consider biological significance alongside statistical significance

    • For transcriptomics data, apply proper normalization and multiple testing correction

  • Integration of Multiple Data Types:

    • Correlate phenotypic observations with molecular data

    • Combine transcriptomic, proteomic, and functional analyses for comprehensive interpretation

    • Consider evolutionary context when interpreting structural or sequence features

    • Validate key findings using complementary methodological approaches

  • Avoiding Common Interpretation Pitfalls:

    • Be cautious about causality claims without direct evidence

    • Consider pleiotropic effects of genetic modifications

    • Acknowledge the limitations of in vitro versus in vivo analyses

    • Distinguish between primary and secondary effects of manipulations

    • Consider potential strain background effects on phenotypes

  • Reporting Standards:

    • Clearly describe all methods in sufficient detail for reproduction

    • Deposit sequence data in appropriate databases

    • Include complete strain information (origin, genotype, verification methods)

    • Report both positive and negative results

    • Provide raw data when possible, especially for key findings

Following these best practices ensures that S. pombe cox2 research produces reliable, reproducible, and meaningful results that advance our understanding of mitochondrial gene expression and function in this important model organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.