Recombinant Schizosaccharomyces pombe Cytochrome c oxidase subunit 3 (cox3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Respiratory Complex IV

Cox3 is integral to CIV’s proton-pumping mechanism and structural stability:

  • Electron Transfer: Facilitates heme-copper oxygen reduction via a binuclear center (heme a₃ and CuB) .

  • Supercomplex Assembly: Binds respiratory supercomplex factor 2 (Rcf2) via its hypoxia-induced gene 1 (Hig1) domain, stabilizing CIV independently of complex III (CIII) .

  • Lipid Interactions: Hosts PE lipids critical for maintaining membrane curvature and proton channel integrity .

Kinetic Behavior

  • Oxygen Reduction: Exhibits µs-ms timescale kinetics, mirroring mammalian CIV .

  • CO Recombination: Monophasic recombination (τ = 6.9 ms) indicates structural homogeneity absent in S. cerevisiae CIV .

Evolutionary Conservation

  • Shares 11 subunits with S. cerevisiae CIV but lacks Cox26 homologs .

  • Mitochondrial genome analysis reveals cox3 conservation across Schizosaccharomyces species (Table 1) .

GeneS. pombeS. octosporusS. japonicus
cox1, cox2, cox3
Group I introns242

Applications in Biochemical Research

  • Drug Discovery: Serves as a target for studying inhibitors of oxidative phosphorylation .

  • Assembly Studies: Used to dissect Rcf1/Rcf2 binding dynamics during CIV maturation .

  • Comparative Genomics: Facilitates evolutionary analysis of fungal respiratory complexes .

Production and Purification Protocols

  • Affinity Chromatography: Twin-strep tagged Cox5 enables CIV isolation with glyco-diosgenin (GDN) .

  • Activity Assays: Measured via cytochrome c-dependent O₂ reduction (340 ± 80 e⁻/s at pH 6.5) .

Challenges and Innovations

  • Detergent Sensitivity: GDN preserves CIV activity better than digitonin, reducing structural heterogeneity .

  • Metal Coordination: Non-redox metal ions (Mg²⁺, Ca²⁺, Zn²⁺) identified in Cox1 and Cox4 subunits .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cox3; SPMIT.04; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cox3
Target Protein Sequence
MNLSTKFQGHPYHIVSASPWPFFLSVVLFFNCLAATLYLHGYKHSSVFFGISFLGLLATM YLWFRDMSTEANIHGAHTKAVTKGLKIGFMLFLISETFLFASIFWAFFHSSLSPTFELGA VWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGLYMTIALSFL FLGGQAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTILLLAATYNIYTYHLTNTHH NGFECGIYYWHFCDVVWLFLYLTIYIWGS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (Cox3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (Cu(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (Cu(B)). The BNC reduces molecular oxygen to two water molecules utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links

STRING: 4896.SPMIT.04.1

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome c oxidase subunit 3 (Cox3) in S. pombe?

Cox3 serves as a core structural component of Complex IV in the mitochondrial respiratory chain of S. pombe. This subunit does not directly participate in electron transfer but plays a crucial role in maintaining the structural integrity of CIV and providing a binding platform for regulatory proteins. Cox3 contains conserved residues that facilitate interactions with hypoxia-induced gene domain-containing proteins, particularly respiratory supercomplex factors (Rcf). Most notably, the highly conserved Asp254 of Cox3 forms specific interactions with the QRRQ motif of Rcf2 (R143 and Q147), which is part of the regulatory mechanism for CIV activity . These interactions are primarily electrostatic in nature and appear to protect the charged membrane-exposed surface of Cox3 .

How does Cox3 differ between S. pombe and other model organisms?

While Cox3 maintains its core function across species, the S. pombe version exhibits specific characteristics that distinguish it from mammalian and S. cerevisiae homologs. In S. pombe, Cox3 interacts with both Rcf1 and Rcf2 through their Hig1 domains at the same binding site, suggesting mutually exclusive binding . This differs from mammalian systems where Higd1a (a type 1 subgroup protein lacking the QRRQ motif) has been identified as a regulatory component of bovine heart CIV but appears to bind at a different position than that observed for Rcf2 in S. pombe . Additionally, while mammalian CIV is often isolated in dimeric form with the monomer-monomer interface at a position equivalent to where Rcf2 binds in S. pombe, suggesting divergent regulatory mechanisms across species .

What is the relationship between Cox3 and the CIII2CIV supercomplex in S. pombe?

Cox3 serves as a crucial structural element in the formation of the CIII2CIV supercomplex. In S. pombe, this supercomplex consists of a dimeric Complex III (CIII2) and a monomeric Complex IV (CIV) with bound cytochrome c as a mobile electron carrier . The interaction between these complexes facilitates efficient electron transfer and enables a dual functionality of the supercomplex in both respiratory electron transfer and enzymatic cleavage of mitochondrial signal sequences . Cox3 is positioned at the interface where regulatory factors such as Rcf2 bind, suggesting its role in stabilizing the supercomplex structure and potentially modulating its activity .

What are the recommended methods for expressing recombinant S. pombe Cox3?

Recombinant expression of S. pombe Cox3 requires careful consideration of growth conditions to maintain respiratory competence. Based on established protocols for Complex IV purification, the following methodology is recommended:

  • Strain Selection: Use strains with epitope tags on other CIV subunits (e.g., Cox5 with a 2xstrep tag) rather than directly tagging Cox3, as this has shown optimal results for complex integrity .

  • Growth Medium:

    • Starter culture: 0.5% yeast extract (YE), 2% glucose, 100 μg/ml ampicillin

    • Pre-culture and large-scale culture: YE with 3% glycerol and 0.1% glucose to promote respiratory-dependent growth

  • Growth Conditions: Incubate at 30°C with shaking at 200 rpm until optimal density is reached .

  • Respiratory Competence Verification: Test strains using drop dilution series on YES plates containing either 2% glucose or 3% glycerol with 0.1% glucose to ensure respiratory function is maintained .

This approach ensures optimal expression of the entire Complex IV with properly integrated Cox3, as direct expression of isolated Cox3 is challenging due to its hydrophobic nature and requirement for co-assembly with other subunits.

What techniques are effective for purifying complexes containing Cox3?

Purification of complexes containing Cox3 from S. pombe can be achieved through the following methodology:

  • Membrane Preparation:

    • Resuspend cells in 0.4 M sorbitol, 50 mM KH2PO4 (pH 7.4), 5 mM EDTA, and 1 mM phenylmethanesulfonyl fluoride

    • Disrupt cells twice using a cell disrupter at 38 kpsi

    • Remove cell debris by centrifugation at 5500 × g for 12 minutes

    • Collect membranes by ultracentrifugation at 120,000 × g for 1 hour at 4°C

    • Homogenize membrane pellets in 50 mM KH2PO4 (pH 8.0)

  • Affinity Purification:

    • For strains with tagged Complex IV subunits (e.g., Cox5-2xstrep), use Strep-Tactin affinity chromatography

    • Solubilize membranes with an appropriate detergent (commonly digitonin or DDM)

    • Perform affinity chromatography under conditions that maintain supercomplex integrity

  • Assessment of Purity:

    • Evaluate using blue native PAGE to verify complex/supercomplex formation

    • Confirm Cox3 presence through western blotting or mass spectrometry

    • Assess respiratory activity using quinol:O2 oxidoreductase assays

This approach enables isolation of intact Complex IV or the CIII2CIV supercomplex containing Cox3 in its native structural context.

How can researchers genetically manipulate the cox3 gene in S. pombe?

Genetic manipulation of cox3 in S. pombe requires specialized approaches due to its mitochondrial location and essential nature. The recommended strategy involves:

  • Marker Selection: For nuclear genes affecting Cox3 function or assembly, selectable markers such as lys2+ or his7+ can be used to mark genetic modifications .

  • PCR-Based Gene Deletion/Modification:

    • Design primers with 80-100 bp homology to the target gene flanking regions

    • Amplify a selectable marker (e.g., lys2+ or his7+) using these primers

    • Transform the PCR product into appropriate host strains

    • Select transformants on media lacking the appropriate supplement

  • Efficiency Considerations:

    • Use deletion strains rather than point mutations as hosts for better efficiency

    • For example, use lys2Δ::his7+ strains when employing lys2+-marked deletion constructs

  • Verification Methods:

    • PCR verification of correct integration

    • Phenotypic assessment of respiratory competence on glycerol media

    • Respiratory complex activity assays

For mitochondrially-encoded cox3 specifically, biolistic transformation methods may be necessary, though these are significantly more challenging and have lower efficiency than nuclear gene modifications.

What structural interactions does Cox3 form with respiratory supercomplex factors?

Cox3 forms critical interactions with respiratory supercomplex factors (Rcf proteins) that regulate Complex IV function:

  • Interaction with Rcf2:

    • The fully conserved R143 and Q147 residues of the QRRQ motif in Rcf2's Hig1 domain interact with the highly conserved Asp254 of Cox3

    • These interactions are primarily electrostatic in nature

    • The Hig1 domain of Rcf2 is positioned at the C-terminus of the protein

  • Interaction with Rcf1:

    • AlphaFold-Multimer modeling reveals that Rcf1 binds at the same position as Rcf2

    • The conserved Hig1 fragment is found at the N-terminus of Rcf1 (unlike Rcf2 where it's at the C-terminus)

    • This architectural difference results in the non-Hig1 portions of these proteins being exposed at different positions relative to Cox3

  • Binding Dynamics:

    • Binding of Rcf1 and Rcf2 to Cox3 appears to be mutually exclusive

    • Rcf2 rather than Rcf1 is typically seen bound to fully assembled and active CIV

    • This suggests Rcf1 may act as an assembly factor that is replaced by Rcf2 in mature CIV

These structural interactions have functional consequences for electron transfer efficiency and potentially for the assembly and stability of the respiratory supercomplex.

How does Cox3 contribute to the dual functionality of the CIII2CIV supercomplex?

The CIII2CIV supercomplex in S. pombe exhibits a dual role in both respiratory electron transfer and enzymatic cleavage of mitochondrial signal sequences . Cox3's contribution to this dual functionality involves:

  • Structural Support:

    • Cox3 provides a stable binding platform for Rcf proteins

    • Its interaction with other subunits helps maintain the optimal positioning of redox centers

  • Proteolytic Activity Connection:

    • In the CIII2CIV supercomplex, the CIII component contains Cor1 and Cor2 subunits

    • Cor1 is homologous to the β-subunit of mitochondrial processing peptidase (MPP)

    • Cor2 is homologous to the α-MPP subunit

    • In S. pombe, Cor1 harbors a conserved Zn2+-binding motif, similar to plant CIII2 where MPP constitutes an integral part of the complex and provides proteolytic activity

  • Electron Transfer Facilitation:

    • While not directly involved in electron transfer, Cox3's positioning helps maintain the appropriate architecture for efficient electron movement

    • The QH2:O2 oxidoreductase activity of the supercomplex (measured at 20 ± 4 e-/s) decreases significantly upon supercomplex dissociation, highlighting the importance of the intact structure

This dual functionality represents an intriguing evolutionary adaptation where CIII2CIV serves both as a respiratory enzyme and potentially as a processing peptidase in S. pombe .

What techniques are most effective for studying Cox3 interactions within the respiratory complex?

To effectively study Cox3 interactions within respiratory complexes, several complementary approaches are recommended:

  • Cryo-Electron Microscopy:

    • Single-particle cryo-EM has proven highly effective for determining the structure of S. pombe respiratory complexes

    • Resolution of ~3-4 Å can be achieved, revealing key interaction interfaces

    • Sample preparation typically involves purified complexes in detergent micelles or reconstituted in nanodiscs

  • Computational Modeling:

    • AlphaFold-Multimer has demonstrated accuracy in modeling protein-protein interactions

    • This approach successfully predicted the binding mode of Rcf1 to Cox3 that matched experimental observations for Rcf2 binding

    • High confidence predictions (plDDT >90 for transmembrane regions) provide valuable structural insights

  • Functional Assays:

    • Quinol:O2 oxidoreductase activity measurements using reduced decylubiquinol (DQH2) as electron donor

    • Oxygen consumption measurements in the presence of cytochrome c

    • Comparison of activity before and after detergent-induced dissociation of supercomplexes

  • Spectroscopic Methods:

    • The reaction sequence of reduced enzyme with O2 can be monitored over μs-ms timescales

    • This approach provides insights into the functional consequences of structural arrangements

Combining these techniques provides a comprehensive understanding of Cox3's structural and functional relationships within respiratory complexes.

What are common challenges when working with recombinant S. pombe Cox3?

Researchers face several challenges when working with recombinant S. pombe Cox3:

  • Expression Challenges:

    • Direct expression of isolated Cox3 is problematic due to its hydrophobic nature

    • Respiratory-dependent growth conditions are required for proper expression

    • Strain selection is critical as some tagged strains show impaired growth under respiratory conditions

  • Complex Assembly Issues:

    • Cox3 requires proper integration into Complex IV for stability

    • Disruption of interactions with other subunits can lead to degradation or misfolding

    • The presence of assembly factors complicates isolation of intermediate states

  • Purification Difficulties:

    • Maintaining supercomplex integrity during purification requires careful detergent selection

    • The membrane protein nature of Cox3 necessitates specialized solubilization conditions

    • Complex IV activity decreases significantly (~2.5-fold) upon supercomplex dissociation

  • Functional Assessment:

    • Distinguishing between direct effects on Cox3 and indirect effects via other complex components

    • Cytochrome c from S. cerevisiae is often used in assays due to its ~70% sequence identity with S. pombe cytochrome c, potentially introducing variability

Addressing these challenges requires careful experimental design and appropriate controls to ensure reliable results.

How can researchers differentiate between effects on Cox3 versus other components of Complex IV?

Differentiating between direct effects on Cox3 and effects on other Complex IV components requires a systematic approach:

  • Site-Directed Mutagenesis:

    • Target conserved residues specific to Cox3 (e.g., Asp254 that interacts with the QRRQ motif)

    • Compare functional effects with mutations in interacting partners

    • Analyze structure-function relationships through activity assays

  • Protein-Protein Interaction Analysis:

    • Use AlphaFold-Multimer modeling to predict interaction interfaces

    • Verify predictions through targeted mutations of interface residues

    • Assess stability of complexes through blue native PAGE or other separation techniques

  • Comparative Studies:

    • Examine the same modifications across different yeast species (S. pombe vs. S. cerevisiae)

    • Analyze phenotypic differences to isolate Cox3-specific effects

    • Compare binding partners (e.g., Rcf1 vs. Rcf2) that interact with the same site on Cox3

  • Assembly Intermediate Analysis:

    • Track the incorporation of Cox3 into assembly intermediates

    • Monitor the recruitment of other subunits and assembly factors

    • Correlate structural changes with functional outcomes

This systematic approach helps researchers distinguish direct effects on Cox3 from broader impacts on Complex IV structure and function.

What are the best practices for ensuring reproducibility in Cox3 research?

Ensuring reproducibility in S. pombe Cox3 research requires adherence to several best practices:

  • Strain Maintenance and Verification:

    • Regularly confirm respiratory competence through growth on glycerol media

    • Verify strain genotypes through molecular methods before experiments

    • Maintain frozen stocks at early passage numbers to prevent genetic drift

  • Growth Condition Standardization:

    • Strictly control media composition, particularly carbon sources

    • Maintain consistent temperature (30°C) and agitation (200 rpm) during growth

    • Monitor growth phases carefully as respiratory complex expression can vary

  • Purification Protocol Consistency:

    • Standardize membrane preparation procedures

    • Use the same detergent concentrations and buffer compositions across experiments

    • Document all deviations from established protocols

  • Activity Measurement Controls:

    • Include technical replicates (at least two) from independent preparations

    • Report standard deviations rather than single measurements

    • Incorporate appropriate positive and negative controls in each experiment

  • Data Reporting Transparency:

    • Provide detailed methodological information

    • Include raw data when possible

    • Clearly state the number of biological and technical replicates

Following these practices enhances the reliability and reproducibility of Cox3 research findings.

What are promising areas for future research on S. pombe Cox3?

Several promising research directions for S. pombe Cox3 include:

  • Regulatory Mechanisms:

    • Further investigation of the mutually exclusive binding of Rcf1 and Rcf2 to Cox3

    • Elucidation of the switching mechanism between these regulatory factors during assembly

    • Exploration of how the different positioning of non-Hig1 domains affects function

  • Dual Functionality Exploration:

    • Detailed characterization of the potential proteolytic activity of the CIII2CIV supercomplex

    • Investigation of the Zn2+-binding motif in Cor1 and its role in processing peptidase activity

    • Comparison with plant systems where CIII2 serves as both respiratory enzyme and MPP peptidase

  • Structural Dynamics:

    • Time-resolved studies of complex assembly and regulatory factor binding

    • Investigation of structural changes during electron transfer reactions

    • Analysis of supercomplex stability under different physiological conditions

  • Comparative Systems Biology:

    • Exploration of the evolutionary adaptations of Cox3 across species

    • Investigation of differences in regulatory mechanisms between S. pombe and mammalian systems

    • Analysis of how structural variations impact functional outcomes

These research directions would significantly advance our understanding of Cox3's role in respiratory complex function and regulation.

How might advanced genetic techniques enhance Cox3 research?

Advanced genetic techniques offer significant opportunities to enhance Cox3 research:

  • CRISPR-Cas9 Mitochondrial Genome Editing:

    • Development of methods for direct editing of the mitochondrial genome in S. pombe

    • Introduction of site-specific mutations in cox3 to study structure-function relationships

    • Creation of tagged versions of Cox3 for improved tracking and purification

  • Synthetic Biology Approaches:

    • Design of artificial Cox3 variants with altered interaction interfaces

    • Creation of chimeric proteins to investigate domain-specific functions

    • Development of biosensors to monitor Cox3 integration into complexes in vivo

  • Conditional Expression Systems:

    • Implementation of inducible promoters for controlled expression of Cox3 assembly factors

    • Creation of degron-tagged versions of interacting partners for temporal studies

    • Development of systems for rapid depletion or induction of Cox3-interacting proteins

  • High-Throughput Genetic Screens:

    • Systematic identification of genes affecting Cox3 function through genome-wide screens

    • Analysis of genetic interactions to map functional relationships

    • Discovery of novel regulatory factors through suppressor screens

These advanced genetic approaches would provide powerful tools for dissecting the complex regulatory networks surrounding Cox3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.