Recombinant Schizosaccharomyces pombe Cytochrome c1, heme protein, mitochondrial (cyt1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Schizosaccharomyces pombe Cytochrome c1, a heme-containing protein located in the mitochondria, is a vital component of the respiratory chain . Cytochrome c1 facilitates electron transfer within the respiratory chain, specifically Complex III, which is essential for cellular energy production . The S. pombe Cyt c1 has been studied to understand its structure, function, and interactions with other proteins, as well as its role in cellular processes such as oxidative stress response and cell respiration .

Protein Structure and Characteristics

S. pombe Cytochrome c1 has distinct chromatographic and spectral properties. When compared to iso-1-cytochrome c from baker's yeast, S. pombe cytochrome c displays a lower affinity for Amberlite IRP64 . Spectrally, the alpha absorption band of S. pombe cytochrome c splits into three maxima (α1, α2, and α3) at -190 degrees Celsius, which is unusual among yeasts . An unmethylated form of cytochrome c can be separated via Amberlite chromatography, exhibiting similar low-temperature splitting of the alpha absorption band but differing in amino-acid composition .

Gene Structure and Expression

The cytochrome c gene of S. pombe has been cloned utilizing the Saccharomyces cerevisiae iso-1-cytochrome c gene as a molecular hybridization probe . The DNA sequence of the S. pombe cytochrome c gene has been determined, confirming the previously established protein sequence with minor exceptions . Introduction of the S. pombe cytochrome c gene into a S. cerevisiae mutant lacking functional cytochrome c restores the ability of the mutant to grow on non-fermentable carbon sources . This indicates that the S. pombe cytochrome c gene contains all regulatory signals necessary for its expression in S. cerevisiae .

Role in Oxidative Stress Response

S. pombe cells lacking Cbf11, a CSL protein, exhibit resistance to hydrogen peroxide, indicating a role in oxidative stress response . The absence of Cbf11 affects cell respiration and energy metabolism, leading to differential regulation of genes involved in respiration control .

Interactions with Other Proteins

Cbf11, a transcription factor in S. pombe, contains two defined domains: RHR-N and BTD . The deletion of cbf11 has pleiotropic effects on S. pombe cells, modifying their morphology, growth, cell and nuclear division, and colony appearance . The Sty1 stress-activated protein kinase cascade, the main stress-response pathway in S. pombe, is upregulated in cbf11KO cells, suggesting that Cbf11 is involved in regulating stress-response genes .

Function in Respiratory Complex Biogenesis

Homologs of Cbp3, Cbp6, and Mss51 in S. pombe are involved in the post-translational steps of respiratory complexes III and IV assembly . Unlike in Saccharomyces cerevisiae, these proteins are not required for the translation of mitochondrial mRNAs in S. pombe, but they fulfill post-translational functions .

Data Table: Properties of Schizosaccharomyces pombe Cytochrome c

PropertyDescription
Source OrganismSchizosaccharomyces pombe (fission yeast)
FunctionComponent of the mitochondrial respiratory chain, facilitates electron transfer in Complex III
PurificationPurified using chromatographic methods
Spectral PropertiesAlpha absorption band splits into three maxima (α1, α2, α3) at -190°C
Affinity for Amberlite IRP64Lower affinity compared to Saccharomyces cerevisiae iso-1-cytochrome c
Genetic InformationGene cloned and sequenced, regulatory signals allow expression in S. cerevisiae
Role in Stress ResponseInvolved in oxidative stress response; deletion of Cbf11 affects stress-response genes
InteractionsInteracts with Cbf11, Cbp3, Cbp6, Mss51, and other proteins involved in cell cycle, stress response, and mitochondrial function
Post-translational functionCbp3, Cbp6, and Mss51 homologs are involved in the post-translational steps of respiratory complexes III and IV assembly, in contrast to Saccharomyces cerevisiae where they are required for the translation of mitochondrial mRNAs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cyt1; SPBC29A3.18; Cytochrome c1, heme protein, mitochondrial; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-307
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
cyt1
Target Protein Sequence
GPSLSAGTPKEEGLHFIQHDWPQSKVLSGFDHASLRRGFQVYREVCSACHSLNLIAWRHL VGVTHTADEAKQMASEVEYEDGPDDEGNMFKRPGKLSDFLPPPYPNVEAARASNNGAAPP DLSCVVRGRHGGQDYIYSLLTGYTEPPAGVEVPDGMNFNPFFPGTQIAMARPLFDDAVEF EDGTPATTAQAAKDVVNFLHWASEPELDIRKKMGFQVITVLTILTALSMWYKRFKWTPIK NRKIFYQRPIK
Uniprot No.

Target Background

Function

Cytochrome c1 is a component of ubiquinol-cytochrome c oxidoreductase (complex III, CIII), a multi-subunit transmembrane complex within the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, encompassing three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Complex III catalyzes electron transfer from ubiquinol to cytochrome c, coupling this redox reaction with proton translocation across the inner mitochondrial membrane via the Q cycle. This process consumes two protons from the matrix, releases four protons into the intermembrane space, and transfers two electrons to cytochrome c. Cytochrome c1, a catalytic core subunit containing a c-type heme, facilitates electron transfer from the Rieske protein's [2Fe-2S] iron-sulfur cluster to cytochrome c.

Database Links
Protein Families
Cytochrome c family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural organization of Schizosaccharomyces pombe Cytochrome c1 and how does it function in the mitochondrial respiratory chain?

Schizosaccharomyces pombe Cytochrome c1 (cyt1) is an essential component of the mitochondrial respiratory complex III (ubiquinone-cytochrome c oxidoreductase or cytochrome bc1 complex). This heme-containing protein serves as an electron transfer component that accepts electrons from the Rieske iron-sulfur protein and transfers them to the mobile carrier cytochrome c .

Structurally, S. pombe cytochrome c1 contains:

  • A single heme group covalently attached via thioether bonds

  • A transmembrane domain anchoring it to the inner mitochondrial membrane

  • A large hydrophilic domain extending into the intermembrane space

  • A C-terminal domain involved in interactions with other complex III components

In the respiratory chain, cytochrome c1 functions at a crucial junction in electron transfer:

  • It receives electrons from the Rieske iron-sulfur protein within complex III

  • It transfers these electrons to the mobile carrier cytochrome c

  • This transfer enables cytochrome c to deliver electrons to complex IV (cytochrome c oxidase)

Recent cryo-electron microscopy studies of the S. pombe CIII2CIV supercomplex have revealed the precise structural organization of cytochrome c1 within this assembly, showing how it positions itself optimally for electron transfer to cytochrome c .

How does the genetic structure of the S. pombe cytochrome c gene differ from S. cerevisiae, and what are the implications for expression systems?

The cytochrome c gene of S. pombe displays significant differences from its S. cerevisiae counterpart while maintaining functional conservation. DNA sequence analysis revealed several key distinctions:

  • Codon usage patterns differ between the two species. While S. cerevisiae shows nonrandom distribution of silent third base differences between its two cytochrome c genes (CYC1 and CYC7), this pattern is not observed in S. pombe, suggesting fewer constraints on DNA sequence conservation beyond protein function and codon usage .

  • Despite these differences, the S. pombe cytochrome c gene contains all regulatory signals required for expression in S. cerevisiae. Introduction of the S. pombe cytochrome c gene on a yeast plasmid into an S. cerevisiae cytochrome c-deficient mutant successfully restored growth on non-fermentable carbon sources .

  • Amino acid differences between the cytochrome c proteins of the two yeasts do not significantly affect protein function in vivo, indicating functional conservation despite sequence divergence .

These findings have important implications for expression systems:

  • S. pombe regulatory elements can function in heterologous systems

  • The protein can be functionally expressed in other organisms

  • Cross-species complementation is possible, making S. pombe cytochrome components valuable tools for studying respiratory chain function

What methods are most effective for expression and purification of recombinant S. pombe cytochrome c1?

For optimal expression and purification of recombinant S. pombe cytochrome c1, researchers should consider the following methodological approach:

Expression System Selection:

  • Homologous expression in S. pombe:

    • Utilize vectors such as pCAD1, which integrates at the leu1 locus

    • Expression can be controlled using the thiamine-repressible nmt1 promoter

    • The native mitochondrial targeting sequence is fully functional in S. pombe

  • Heterologous expression alternatives:

    • E. coli systems require co-expression of cytochrome c maturation genes (ccm)

    • S. cerevisiae can be used but may require optimization of heme incorporation

Purification Protocol:

  • Cell fractionation: Isolate mitochondria using differential centrifugation

  • Membrane protein extraction: Solubilize membrane fractions with appropriate detergents:

    • n-Dodecyl β-D-maltoside (DDM) at 1-2% concentration

    • Digitonin (1-2%) for native complex preservation

  • Chromatography steps:

    • Ion exchange chromatography (DEAE or Q-Sepharose)

    • Hydroxyapatite chromatography

    • Size exclusion chromatography for final polishing

Quality Control Assessment:

  • Absorption spectroscopy (characteristic peaks at ~553 nm in reduced state)

  • SDS-PAGE with heme staining

  • Western blot using tagged constructs (e.g., His-tag, Pk-tag )

  • Functional assays measuring electron transfer activity

The most successful approach involves expression in S. pombe itself, as the native environment ensures proper heme incorporation and protein folding. Studies have demonstrated that targeted expression in S. pombe mitochondria produces properly assembled and functionally active cytochromes .

How does S. pombe cytochrome c1 contribute to the formation and function of respiratory supercomplexes?

S. pombe cytochrome c1 plays a critical role in respiratory supercomplex formation and function, particularly in the CIII2CIV supercomplex that has been isolated and structurally characterized through cryo-electron microscopy :

Structural Contributions:

  • Cytochrome c1 positions within complex III to form specific contacts with complex IV subunits

  • The orientation of cytochrome c1 creates an optimal docking site for the mobile electron carrier cytochrome c

  • Recent structural data shows that cytochrome c can be found bound at the interface between complexes III and IV, with cytochrome c1 serving as one of the critical interaction points

Functional Significance:

  • Electron channeling: The specific arrangement facilitates efficient electron transfer from complex III to cytochrome c to complex IV

  • Stabilization: Cytochrome c1 contributes to the structural integrity of the supercomplex

  • Dynamic interactions: The positioning allows for transient binding of cytochrome c, essential for efficient electron transport

Research Data on Supercomplex Formation:
The structure of the S. pombe CIII2CIV supercomplex reveals that:

  • Cytochrome c1 faces toward the complex IV subunit Cox5

  • A respiratory supercomplex factor 2 binds at complex IV distally positioned in the supercomplex

  • In addition to redox-active metal sites, a metal ion (likely Zn2+) is coordinated in the CIII subunit Cor1, encoded by the qcr1 gene

This organization differs from the arrangements seen in S. cerevisiae and mammalian systems, highlighting the value of S. pombe as a distinct model for understanding respiratory chain supercomplex dynamics.

What experimental approaches can detect and characterize interactions between S. pombe assembly factors and cytochrome c1?

Several experimental approaches are effective for detecting and characterizing interactions between S. pombe assembly factors and cytochrome c1:

In vivo approaches:

  • Co-immunoprecipitation (Co-IP):

    • Using tagged versions of cytochrome c1 or assembly factors

    • Example protocol: Express Pk-tagged cytochrome c1 in S. pombe, prepare mitochondrial lysates, immunoprecipitate with anti-Pk antibodies, and analyze co-precipitating proteins by mass spectrometry or Western blotting

    • This approach successfully identified interactions between complex IV assembly factor Shy1 and components of complexes III and IV

  • Yeast two-hybrid systems:

    • Modified for membrane proteins using split-ubiquitin systems

    • Can detect direct protein-protein interactions

  • Genetic interaction studies:

    • Synthetic genetic array (SGA) analysis in S. pombe

    • Example: The interaction network surrounding respiratory chain components has been mapped using this approach

In vitro approaches:

  • Surface plasmon resonance (SPR):

    • Measures binding kinetics and affinity between purified components

    • Requires recombinant production of the interacting proteins

  • Proximity-based labeling techniques:

    • BioID or APEX2 fusion proteins for in vivo biotinylation of proximal proteins

    • Useful for identifying transient interactions in the native environment

Structural approaches:

  • Cryo-electron microscopy:

    • Has successfully characterized the S. pombe CIII2CIV supercomplex

    • Can reveal interaction interfaces at near-atomic resolution

  • Cross-linking mass spectrometry:

    • Identifies interaction surfaces between proteins

    • Compatible with membrane protein complexes

A successful example from the literature is the characterization of S. pombe Shy1 (homolog of human SURF1), which was found to interact with both structural subunits and assembly factors of complex IV, as well as with Rip1, a subunit of complex III, suggesting involvement in respiratory supercomplex assembly .

Several sophisticated techniques can be employed to investigate electron transfer mechanisms involving S. pombe cytochrome c1:

Spectroscopic Methods:

  • UV-visible absorption spectroscopy:

    • Track redox state changes of cytochrome c1 (reduced form shows characteristic peaks)

    • Kinetic measurements can determine electron transfer rates

    • Baseline-subtracted difference spectra enhance sensitivity

  • Resonance Raman spectroscopy:

    • Provides information about heme environment and coordination

    • Can detect conformational changes upon reduction/oxidation

  • Electron paramagnetic resonance (EPR):

    • Detects paramagnetic species during electron transfer

    • Can track the redox state of iron-sulfur clusters and heme groups

Electrochemical Approaches:

  • Protein film voltammetry:

    • Immobilize purified cytochrome c1 or complex III on electrodes

    • Measure redox potentials and electron transfer kinetics

    • Example protocol: Modify gold electrodes with self-assembled monolayers to orient cytochrome c1 for direct electron transfer

  • Potentiometric titrations:

    • Determine midpoint potentials of cytochrome c1 within intact complex III

    • Compare with values for human and S. cerevisiae homologs

Real-time Measurements in Living Cells:

  • Oxygen consumption measurements:

    • Respirometry with specific substrates and inhibitors

    • Quantify the impact of mutations on electron transfer efficiency

  • Membrane potential measurements:

    • Fluorescent dyes (e.g., TMRM, JC-1) to monitor ΔΨm

    • Correlate with electron transfer through cytochrome c1

Structural Approaches:

  • Time-resolved crystallography or cryo-EM:

    • Capture intermediates in the electron transfer process

    • Recent structural data on the S. pombe CIII2CIV supercomplex with bound cytochrome c provides a foundation for such studies

Genetic Engineering Approaches:

  • Site-directed mutagenesis:

    • Target residues involved in electron transfer pathways

    • Measure effects on electron transfer rates and respiratory function

    • Example: Mutations in heme-coordinating residues or electron transfer pathway residues

The most informative approach combines multiple techniques to correlate structure with function. Studies on the S. pombe respiratory chain have revealed the importance of supercomplex formation for efficient electron transfer, with cytochrome c found bound at the interface between complexes III and IV .

How do mutations in S. pombe cytochrome c1 impact respiratory chain assembly and function?

Mutations in S. pombe cytochrome c1 can have diverse effects on respiratory chain assembly and function, providing valuable insights into structure-function relationships:

Impact on Complex III Assembly:

  • Heme binding site mutations:

    • Disrupt covalent attachment of heme group

    • Prevent proper folding and assembly of cytochrome c1 into complex III

    • Lead to degradation of unassembled subunits

  • Transmembrane domain mutations:

    • Impair membrane integration and complex stability

    • Affect interactions with other complex III subunits

Effects on Supercomplex Formation:
S. pombe forms a CIII2CIV supercomplex with bound cytochrome c . Mutations in cytochrome c1 can disrupt this organization by:

  • Altering interface residues that contact complex IV

  • Changing the positioning of the heme group, affecting electron transfer

  • Modifying the docking site for cytochrome c

Functional Consequences:
Respiratory chain defects in S. pombe manifest as:

  • Growth defects on non-fermentable carbon sources

  • Reduced oxygen consumption rates

  • Increased production of reactive oxygen species

  • Mitochondrial membrane potential changes

Methodological Approach for Mutation Analysis:

  • Generate point mutations using site-directed mutagenesis

  • Integrate mutations at the native locus using homologous recombination

  • Assess respiratory growth, oxygen consumption, and ROS production

  • Analyze complex assembly using blue native PAGE

  • Determine supercomplex formation via cryo-EM or BN-PAGE

Experimental Data from Mutation Studies:

Mutation TypeAssembly EffectFunctional ImpactDetection Method
Heme-binding site (CXXCH motif)Impaired complex III assemblyRespiratory deficiencyBN-PAGE, spectroscopy
Interface mutationsDisrupted supercomplex formationReduced electron transfer efficiencyBN-PAGE, respirometry
Transmembrane domainDestabilized complex IIIGrowth defects on glycerolBN-PAGE, growth assays

These studies complement research on complex III assembly factors like Cbp3 and Cbp6, which in S. pombe function exclusively in post-translational steps rather than translation as they do in S. cerevisiae , highlighting important differences between these model organisms.

What are the key differences between S. pombe cytochrome c1 and S. cerevisiae cytochrome c1 in terms of regulation and function?

The cytochrome c1 proteins of S. pombe and S. cerevisiae show important differences in regulation and function, reflecting their evolutionary divergence:

Genetic and Structural Differences:

  • Gene organization:

    • Different codon usage patterns between species

    • S. pombe lacks the nonrandom distribution of silent third base differences seen in S. cerevisiae cytochrome genes

  • Protein structure:

    • Amino acid differences exist but don't drastically affect in vivo function

    • Structural studies of the S. pombe CIII2CIV supercomplex reveal distinct arrangements compared to S. cerevisiae

Regulatory Differences:

Functional Context Differences:

  • Respiratory metabolism:

    • S. pombe is petite-negative (cannot survive without mitochondrial DNA)

    • S. cerevisiae is petite-positive (can survive with severely compromised mitochondrial function)

    • This creates different selective pressures on respiratory chain components

  • Supercomplex organization:

    • S. pombe forms CIII2CIV supercomplexes with distinct features

    • The positioning of cytochrome c1 relative to complex IV differs between species

Evolutionary Implications:
The conservation of post-translational functions of assembly factors like Mss51, Cbp3, and Cbp6 in both species suggests this is their ancestral role, while their translational control function in S. cerevisiae may be a specialized adaptation for facultative anaerobiosis .

These differences make S. pombe a valuable complementary model to S. cerevisiae for studying respiratory chain function, particularly for aspects more closely resembling the human system.

What techniques can be used to analyze the integration of recombinant S. pombe cytochrome c1 into the mitochondrial membrane?

Analyzing the integration of recombinant S. pombe cytochrome c1 into the mitochondrial membrane requires specialized techniques to address the challenges of membrane protein biology:

Subcellular Fractionation and Localization:

  • Differential centrifugation with verification markers:

    • Isolate mitochondria using sucrose gradient centrifugation

    • Verify using specific markers for different fractions (e.g., porin for mitochondrial outer membrane)

  • Protease protection assays:

    • Treat intact mitochondria with proteases (e.g., proteinase K)

    • Properly integrated cytochrome c1 shows a specific digestion pattern

    • The C-terminal domain should be protected in intact mitochondria

  • Membrane extraction analysis:

    • Treat with increasing detergent concentrations or carbonate extraction

    • Integral membrane proteins (like cytochrome c1) resist carbonate extraction

Visualization Techniques:

  • Fluorescence microscopy with tagged constructs:

    • Express cytochrome c1 with GFP or similar tags

    • Co-localize with mitochondrial markers (e.g., MitoTracker dyes)

    • Example protocol: Transform S. pombe with cyt1-GFP constructs under the nmt1 promoter, visualize using confocal microscopy

  • Immunogold electron microscopy:

    • Provides ultrastructural localization

    • Can distinguish between inner and outer mitochondrial membrane localization

Functional Integration Assessment:

  • Spectroscopic analysis:

    • Measure absorption spectra of isolated mitochondria

    • Detect characteristic peaks of properly integrated cytochrome c1

  • Respiratory chain complex assembly:

    • Blue Native PAGE to analyze incorporation into complex III

    • In-gel activity assays for functional assessment

    • Similar approaches have been used successfully to study complex IV assembly

Example Experimental Protocol:
Successful expression of human proteins in S. pombe mitochondria has been achieved using:

  • Integration vectors like pCAD1

  • The strong, thiamine-repressible nmt1 promoter

  • The native mitochondrial targeting sequence, which is fully functional in S. pombe

Implementation of these techniques has revealed that human mitochondrial localization sequences are functional in S. pombe, highlighting the similarity between fission yeast and human mitochondrial import machinery , making S. pombe an excellent model for studying mitochondrial protein integration.

How can recombinant S. pombe cytochrome c1 be used as a tool to study the biogenesis of respiratory complexes?

Recombinant S. pombe cytochrome c1 serves as an excellent tool for investigating respiratory complex biogenesis through multiple experimental approaches:

Tracking Assembly Intermediates:

  • Tagged cytochrome c1 as an assembly marker:

    • Express epitope-tagged versions (e.g., HA, Pk, or FLAG-tagged cytochrome c1)

    • Immunoprecipitate at different time points after induction

    • Identify co-precipitating proteins to map the assembly pathway

    • Mass spectrometry analysis of complexes at different assembly stages

  • Pulse-chase experiments:

    • Label newly synthesized proteins with 35S-methionine/cysteine

    • Chase with unlabeled amino acids

    • Track the incorporation of labeled cytochrome c1 into complexes over time

    • This approach has been successfully used in S. pombe to study mitochondrial protein synthesis

Identification of Assembly Factors:

  • Genetic screens:

    • Use synthetic genetic array (SGA) technique in S. pombe

    • Identify genes that show genetic interactions with cytochrome c1 mutations

    • This approach has been successfully applied in S. pombe to identify functional networks

  • Proximity-based labeling:

    • Fuse BioID or APEX2 to cytochrome c1

    • Identify proteins in close proximity during assembly

    • Validate interactions by co-immunoprecipitation

Assembly Defect Analysis:

  • Blue Native PAGE combined with 2D SDS-PAGE:

    • Visualize assembly intermediates and subcomplexes

    • Track the incorporation of cytochrome c1 into complex III and supercomplexes

    • Quantify the ratio of fully assembled complex to intermediates

  • Time-course analysis of complex formation:

    • Using inducible expression systems (e.g., nmt1 promoter)

    • Sample at intervals after induction

    • Monitor assembly state using BN-PAGE and activity assays

Research Applications:
Studies in S. pombe have revealed important insights about respiratory complex assembly:

  • Assembly factors like Cbp3, Cbp6, and Mss51 function exclusively in post-translational steps in S. pombe, unlike in S. cerevisiae where they also control translation

  • Shy1, the S. pombe homolog of human SURF1, interacts with both complex III and IV components, suggesting a role in supercomplex assembly

  • The integration of complex III into supercomplexes with complex IV can be visualized and studied through cryo-EM

These approaches make S. pombe particularly valuable for understanding the fundamental processes of respiratory chain assembly that are conserved between yeast and humans.

What are the most reliable methods for quantifying the activity of recombinant S. pombe cytochrome c1 in vitro and in vivo?

Reliable quantification of recombinant S. pombe cytochrome c1 activity requires both in vitro and in vivo approaches to provide complementary data:

In Vitro Activity Assays:

  • Spectrophotometric enzyme assays:

    • Measure complex III activity using decylubiquinol as electron donor and cytochrome c as acceptor

    • Monitor reduction of cytochrome c at 550 nm

    • Calculate activity as nmol cytochrome c reduced/min/mg protein

    • Example protocol parameters:

      • Buffer: 50 mM potassium phosphate, pH 7.4

      • Substrate: 50 μM decylubiquinol

      • Electron acceptor: 50 μM cytochrome c

      • Inhibitor controls: antimycin A (1 μM) and myxothiazol (1 μM)

  • Electron transfer rate measurements:

    • Stopped-flow kinetic analysis to determine electron transfer rates

    • Measure the rate of cytochrome c1 oxidation/reduction

    • Calculate second-order rate constants

  • Redox potential determination:

    • Potentiometric titrations to determine midpoint potentials

    • Compare wild-type vs. mutant cytochrome c1 variants

In Vivo Activity Assessment:

  • Oxygen consumption measurements:

    • High-resolution respirometry using intact cells or isolated mitochondria

    • Measure oxygen consumption with different substrates:

      • NADH-linked substrates (complex I-dependent)

      • Succinate (complex II-dependent)

      • Glycerol-3-phosphate (entering at coenzyme Q)

    • Use specific inhibitors to distinguish individual complex contributions

  • Growth rate analysis:

    • Quantitative growth curves in fermentable vs. non-fermentable carbon sources

    • Calculate doubling times and maximum growth rates

    • Example growth media:

      • Fermentable: YES with 2% glucose

      • Non-fermentable: YES with 3% glycerol

  • Membrane potential measurements:

    • Use fluorescent dyes (TMRM, JC-1) to quantify mitochondrial membrane potential

    • Flow cytometry for population analysis

    • Confocal microscopy for single-cell analysis

Standardization and Controls:

To ensure reliability, include these essential controls:

  • Complex III-specific inhibitors (antimycin A, myxothiazol)

  • Cytochrome c1 deletion strains as negative controls

  • S. cerevisiae complementation for cross-species validation

  • Purified bovine complex III as activity reference standard

These methods have been successfully applied to study respiratory chain components in S. pombe, including the characterization of complex IV assembly factor Shy1 and its impact on respiratory function , providing robust protocols that can be adapted for cytochrome c1 studies.

How does the post-translational modification landscape of S. pombe cytochrome c1 differ from other model organisms?

The post-translational modification (PTM) landscape of S. pombe cytochrome c1 exhibits distinct characteristics compared to other model organisms, reflecting both evolutionary conservation and specialization:

Heme Attachment and Processing:

  • Heme c attachment mechanism:

    • Conserved CXXCH motif serves as the heme attachment site

    • S. pombe uses a dedicated cytochrome c heme lyase (CCHL) system

    • Unlike in some bacteria, S. pombe requires specific CCHL enzymes rather than the Ccm system

  • Proteolytic processing:

    • Import into mitochondria includes cleavage of the N-terminal targeting sequence

    • S. pombe mitochondrial processing peptidase (MPP) resembles human MPP more closely than S. cerevisiae MPP

    • The dual role of CIII subunit Cor1 (encoded by qcr1) as both respiratory complex component and mitochondrial processing peptidase subunit β has been observed in S. pombe

Regulatory PTMs:

  • Phosphorylation sites:

    • Phosphoproteomic studies have identified distinct phosphorylation patterns

    • These may regulate electron transfer activity or protein-protein interactions

    • The PKC homologues pck1p and pck2p in S. pombe could potentially mediate such phosphorylation events

  • Oxidative modifications:

    • Susceptibility to oxidative damage differs between species

    • These modifications may serve as redox sensors

Comparative Analysis of PTMs:

ModificationS. pombeS. cerevisiaeMammalsFunctional Implication
Heme attachmentCXXCH motif, specific CCHLCXXCH motif, specific CCHLCXXCH motif, specific CCHLEssential for electron transfer
N-terminal processingMPP cleavageMPP cleavageTwo-step processing (MPP + IMP)Mature protein formation
PhosphorylationFewer sitesMultiple sitesExtensively phosphorylatedSpecies-specific regulation
Metal coordinationZn2+ in Cor1 (qcr1)Similar metal sitesSimilar metal sitesStructural stabilization

Methodological Approaches for PTM Analysis:

  • Mass spectrometry-based proteomics:

    • Enrichment strategies for phosphopeptides, oxidized peptides

    • High-resolution MS/MS for precise PTM mapping

    • Quantitative approaches to determine stoichiometry

  • Site-directed mutagenesis:

    • Mutate potential PTM sites and assess functional consequences

    • Create phosphomimetic mutations (S/T to D/E) or phosphodeficient mutations (S/T to A)

  • PTM-specific antibodies:

    • Western blotting with phospho-specific antibodies

    • Immunoprecipitation to enrich modified forms

Understanding these differences is crucial for using S. pombe as a model system for human mitochondrial disorders and for interpreting data from different experimental systems.

What bioinformatic tools and databases are most useful for analyzing S. pombe cytochrome c1 sequence, structure, and function?

For comprehensive analysis of S. pombe cytochrome c1, researchers should utilize a combination of specialized bioinformatic tools and databases:

S. pombe-Specific Resources:

  • PomBase (https://www.pombase.org):

    • The primary genome database for S. pombe

    • Contains gene annotations, protein features, and phenotype data

    • Includes the Gene Ontology (GO) slim sets for functional annotation

    • Provides curated literature references for cytochrome c1 (cyt1) and related proteins

  • PombeNet:

    • Network visualization tool for S. pombe protein interactions

    • Useful for identifying functional partners of cytochrome c1

Sequence Analysis Tools:

  • Multiple sequence alignment tools:

    • MUSCLE or CLUSTAL Omega for alignment of cytochrome c1 across species

    • T-Coffee for alignment incorporating structural information

  • Domain prediction tools:

    • TMHMM for transmembrane domain prediction

    • SignalP for mitochondrial targeting sequence analysis

    • Motif identification using MEME Suite to find conserved motifs

Structural Analysis Resources:

  • Protein structure databases:

    • PDB (Protein Data Bank) for experimentally determined structures

    • Recent cryo-EM structures of the S. pombe CIII2CIV supercomplex

    • AlphaFold DB for AI-predicted structures

  • Structural visualization and analysis:

    • PyMOL or UCSF Chimera for visualization and analysis

  • Molecular docking tools:

    • HADDOCK or RosettaDock for modeling protein-protein interactions

    • Useful for predicting cytochrome c1 interactions with cytochrome c

Evolutionary Analysis:

  • Phylogenetic analysis packages:

    • MEGA X for comprehensive phylogenetic analysis

    • IQ-TREE for maximum likelihood phylogeny

  • Selection analysis tools:

    • PAML for detecting sites under positive selection

    • HYPHY for testing evolutionary hypotheses

Functional Prediction:

  • Electron transfer pathway analysis:

    • HARLEM for prediction of electron tunneling pathways

    • PATHWAYS for electron transfer pathway calculation

  • Integration with interactome data:

    • STRING database for protein interaction networks

    • BioGRID for curated protein interaction data

These resources can be combined in an analysis pipeline to comprehensively characterize S. pombe cytochrome c1, from sequence features to structural properties to functional interactions within the respiratory chain.

How can researchers overcome challenges in expressing and studying membrane-bound portions of S. pombe cytochrome c1?

Studying the membrane-bound portions of S. pombe cytochrome c1 presents significant challenges that can be addressed through specialized techniques:

Expression System Optimization:

  • Cell-free expression systems:

    • Wheat germ or insect cell extracts supplemented with lipids or detergents

    • Allow direct incorporation into nanodiscs or liposomes

    • Avoid toxicity issues associated with membrane protein overexpression

  • Specialized inducible promoters:

    • Use the thiamine-repressible nmt1 promoter with varying strengths (full, intermediate, or weak versions)

    • Implement a tetracycline-inducible system for fine-tuned expression control

    • Example: The nmt1 promoter system has been successfully used for expression of human mitochondrial proteins in S. pombe

Solubilization and Stabilization Strategies:

  • Detergent screening:

    • Systematic testing of detergent types and concentrations:

      • Mild detergents: DDM, digitonin

      • Intermediate detergents: UDM, LMNG

      • Harsh detergents: OG, LDAO

    • Example protocol: Solubilize mitochondrial membranes in buffers containing 1% digitonin or DDM, followed by ultracentrifugation and analysis of the supernatant

  • Membrane mimetics:

    • Nanodiscs with MSP proteins and defined lipid composition

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Amphipols for stabilization after detergent extraction

Structural Analysis Approaches:

  • Construct design for structural studies:

    • Create fusion constructs with soluble proteins (e.g., GFP)

    • Design minimal constructs focusing on specific domains

    • Introduce thermostabilizing mutations based on computational prediction

  • Crystallization alternatives:

    • Lipidic cubic phase crystallization

    • Cryo-electron microscopy (as used successfully for the S. pombe CIII2CIV supercomplex )

    • Electron crystallography of 2D crystals

Functional Reconstitution:

  • Proteoliposome reconstitution:

    • Incorporate purified cytochrome c1 or complex III into defined liposomes

    • Monitor functional activity through spectroscopic measurements

    • Assess lateral mobility using FRAP (fluorescence recovery after photobleaching)

  • Electrophysiological measurements:

    • Reconstitute into planar lipid bilayers for potential measurements

    • Patch-clamp of enlarged mitochondria or proteoliposomes

Example Success Story:
Researchers have successfully expressed human mitochondrial proteins in S. pombe mitochondria using the pCAD1 integration vector and the nmt1 promoter. The human mitochondrial targeting sequences functioned correctly in S. pombe, demonstrating the compatibility of the systems . This approach can be adapted for studying membrane-bound portions of S. pombe cytochrome c1.

What are the key experimental controls needed when studying S. pombe cytochrome c1 function and interactions?

When studying S. pombe cytochrome c1 function and interactions, implementing rigorous experimental controls is essential to ensure reliable and interpretable results:

Genetic Controls:

  • Deletion and complementation controls:

    • Complete cytochrome c1 deletion strain (cyt1Δ)

    • Rescue with wild-type cytochrome c1 expression

    • Heterologous complementation (e.g., human or S. cerevisiae orthologs)

    • Example: The successful cross-species complementation observed with S. pombe cytochrome c in S. cerevisiae provides a template for such experiments

  • Site-directed mutant controls:

    • Catalytically inactive mutants (e.g., heme-binding site mutations)

    • Membrane-targeting mutants

    • Interface mutants that disrupt specific protein-protein interactions

Biochemical Controls:

  • Redox state controls:

    • Fully reduced samples (sodium dithionite treatment)

    • Fully oxidized samples (ferricyanide treatment)

    • Analysis of extinction coefficients at key wavelengths

    • Cytochrome c1 shows characteristic absorption peaks in its reduced state

  • Inhibitor controls:

    • Complex III-specific inhibitors (antimycin A, myxothiazol, stigmatellin)

    • Respiratory chain uncouplers (FCCP, CCCP)

    • ATP synthase inhibitors (oligomycin)

Expression and Localization Controls:

  • Expression level verification:

    • Western blotting with appropriate antibodies

    • qRT-PCR for mRNA levels

    • Comparison to native expression levels

  • Subcellular fractionation controls:

    • Mitochondrial markers (e.g., Cox4, porin)

    • Cytosolic markers (e.g., GAPDH)

    • ER markers (e.g., Cnx1 )

    • Nuclear markers (e.g., histone H3)

Interaction Assay Controls:

  • Co-immunoprecipitation controls:

    • Non-specific IgG precipitation control

    • Bead-only control

    • Known interactor positive control (e.g., other complex III subunits)

    • Non-interacting protein negative control

    • DNase/RNase treatment to eliminate nucleic acid-mediated interactions

  • Proximity labeling controls:

    • Catalytically inactive enzyme fusion

    • Targeting to irrelevant cellular compartment

    • Omission of biotin or other substrates

Functional Assay Controls:

  • Respiratory chain activity controls:

    • Electron transport chain bypasses (e.g., ascorbate + TMPD for complex IV)

    • Membrane integrity controls (addition of cytochrome c should not increase activity if membranes are intact)

    • Temperature controls (30°C is standard for S. pombe experiments)

  • Growth assay controls:

    • Growth on fermentable (glucose) vs. non-fermentable (glycerol, ethanol) carbon sources

    • Temperature-dependent phenotypes (standard and elevated temperatures)

    • Oxidative stress conditions (e.g., hydrogen peroxide treatment )

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.