Recombinant Schizosaccharomyces pombe Diacylglycerol O-acyltransferase 1 (dga1)

Shipped with Ice Packs
In Stock

Description

Introduction to Diacylglycerol O-acyltransferase 1 (dga1)

Diacylglycerol O-acyltransferase 1, commonly referred to as dga1, represents a key enzyme in the lipid metabolism pathway of Schizosaccharomyces pombe, a species of fission yeast widely used as a model organism in molecular and cellular biology research. The dga1 gene is also known by several synonyms including SPCC1235.15 and SPCC548.01, and the protein it encodes carries the UniProt ID O74850 . This enzyme belongs to the acyltransferase family and plays a crucial role in lipid biosynthesis and storage.

Schizosaccharomyces pombe has emerged as a powerful tractable system for studying various cellular processes, including DNA damage repair and lipid metabolism. This fission yeast diverged from Saccharomyces cerevisiae (budding yeast) approximately a billion years ago, yet maintains significant genetic similarity to higher eukaryotes, including humans . This evolutionary position makes S. pombe an ideal model organism for studying conserved biological processes, with findings often having relevance to human biology and disease.

In the complex landscape of cellular lipid metabolism, dga1 occupies a strategic position as it catalyzes the final step in triacylglycerol synthesis. Triacylglycerols (TAGs) serve as the primary energy storage molecules in eukaryotic cells, making the enzymes involved in their synthesis particularly important for cellular energy homeostasis and survival during nutrient limitation.

Biochemical Characteristics

The recombinant form of dga1 is typically produced with an N-terminal histidine tag to facilitate purification and characterization. This His-tagged protein has several notable biochemical properties:

PropertyCharacteristics
Molecular WeightApproximately 39 kDa (without tag)
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
StabilityShould be stored at -20°C/-80°C; repeated freeze-thaw cycles should be avoided
FormLyophilized powder

The protein exhibits optimal activity under specific conditions, including neutral to slightly alkaline pH and physiological temperatures. As an enzyme involved in lipid metabolism, dga1 demonstrates strong substrate specificity for diacylglycerol and acyl-CoA donors, with variations in activity depending on the acyl chain length and saturation level of these substrates .

Enzymatic Activity

Diacylglycerol O-acyltransferase 1 (dga1) catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates . This reaction involves the transfer of an acyl group from acyl-CoA to the sn-3 position of diacylglycerol (DAG), resulting in the formation of triacylglycerol. The reaction can be represented as:

Diacylglycerol + Acyl-CoA → Triacylglycerol + CoA

In addition to its primary role, dga1 also exhibits monoacylglycerol acyltransferase (MGAT) activity, catalyzing the acyl-CoA-dependent esterification of monoacylglycerol to diacylglycerol . This dual functionality highlights the versatility of this enzyme in lipid metabolism pathways.

Metabolic Significance

The triacylglycerol synthesis pathway, in which dga1 plays a crucial role, is vital for cellular energy homeostasis and survival. Triacylglycerols serve as the primary energy storage molecules in eukaryotic cells, providing a concentrated source of energy during periods of nutrient limitation. Research has shown that cells defective in triacylglycerol synthesis undergo apoptosis upon entry into the stationary phase, underscoring the essential nature of this metabolic pathway .

The generation of reactive oxygen species (ROS) has been identified as essential to the process of lipoapoptosis that occurs in cells deficient in triacylglycerol synthesis capability . This finding connects lipid metabolism with oxidative stress responses and cell death pathways, revealing complex interactions between metabolic processes and cellular survival mechanisms.

Protein Interaction Network

Within the cellular environment, dga1 functions as part of a broader network of lipid metabolism enzymes. Protein interaction studies have identified several functional partners of dga1 in Schizosaccharomyces pombe, forming a network of enzymes involved in various aspects of lipid metabolism and membrane homeostasis.

Protein PartnerFunctionInteraction Score
ale1Lysophospholipid acyltransferase0.916*
plh1Phospholipid:diacylglycerol acyltransferaseNot specified
ayr1NADPH-dependent 1-acyldihydroxyacetone phosphate reductase0.783**

*Interaction score between ale1 and ayr1
**Interaction score between dga1 and ayr1

These interactions suggest that dga1 operates within a coordinated network of enzymes that collectively regulate lipid synthesis, modification, and degradation to maintain cellular lipid homeostasis.

Expression Systems

The recombinant full-length Schizosaccharomyces pombe Diacylglycerol O-acyltransferase 1 (dga1) protein is typically expressed in Escherichia coli expression systems. E. coli provides several advantages for recombinant protein production, including rapid growth, high protein yields, and well-established genetic manipulation techniques. The specific strain of E. coli used for expression may vary depending on the research requirements and optimization parameters .

For the recombinant expression of dga1, the full-length coding sequence (encompassing amino acids 1-345) is cloned into an appropriate expression vector. To facilitate purification, the construct typically includes an N-terminal histidine tag (His-tag), which allows for efficient isolation of the recombinant protein using affinity chromatography techniques .

Purification Process

The purification of recombinant His-tagged dga1 typically follows a multi-step process designed to isolate the protein with high purity while maintaining its structural integrity and enzymatic activity. The general purification workflow includes:

  1. Cell lysis to release the recombinant protein from E. coli cells

  2. Immobilized metal affinity chromatography (IMAC) using the His-tag for selective binding

  3. Additional chromatographic steps to remove impurities, if necessary

  4. Buffer exchange and concentration of the purified protein

  5. Quality control analysis, including SDS-PAGE to confirm purity (typically >90%)

  6. Lyophilization to produce the final powder form for storage and distribution

Lipid Metabolism Studies

Recombinant dga1 serves as a valuable tool for studying lipid metabolism in Schizosaccharomyces pombe and related organisms. The availability of purified, active enzyme allows researchers to conduct in vitro assays to characterize the enzymatic properties, substrate preferences, and kinetics of triacylglycerol synthesis. These studies provide insights into the fundamental mechanisms of lipid metabolism and how they contribute to cellular energy homeostasis.

Additionally, the recombinant protein can be used to generate antibodies for immunolocalization and Western blot analysis, enabling researchers to study the expression, localization, and regulation of native dga1 in various cellular contexts and experimental conditions.

Biotechnological Applications

Beyond basic research, recombinant dga1 has potential applications in biotechnology, particularly in areas related to lipid engineering and biofuel production. The enzyme's ability to catalyze the synthesis of triacylglycerols makes it a candidate for use in biofuel production processes that aim to generate lipid-based fuels. By understanding and potentially modifying the catalytic properties of dga1, researchers may be able to enhance its efficiency or alter its substrate specificity for specific biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
dga1; SPCC1235.15; SPCC548.01; Diacylglycerol O-acyltransferase 1; Diglyceride acyltransferase; Triacylglycerol synthase; TAG synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
dga1
Target Protein Sequence
MSEETSIPGIIASTPPISKDSRRNVSHWLQALAVFLHSVSLTLTASWYTVLWAFLPFWPF LIVYLIWLIYDDGFVTGKDRQKRWLRNAPPYRWFCHYFPIRLHKTTELDSEKNYIFGYHP HGIISLGAFGGFASEGADFSKLFPGINVSVLTLNSNFYVPVYRDYLMALNINSVSKKSCV SILSRKPGDSVLIVIGGAQESLLSRPGQNNLVLKKRFGFVKLAFLTGSSLVPCFAFGESD IFEQVDNNPRTRIYKFQEIVKKIAGFTVPFFYGRGLLNKTFGLMPWRKPINIVVGEPIDV PKKSHPTNQEIYEVHEEYIRRLEGLWNKYKDVFLPNRISELKLSA
Uniprot No.

Target Background

Function
This enzyme catalyzes the terminal and committed step in triacylglycerol (TAG) synthesis, utilizing diacylglycerol (DAG) and fatty acyl-CoA as substrates. It is essential for storage lipid synthesis and serves as the primary DAG esterifying enzyme during stationary phase when TAG production is particularly active. It plays a role in lipid particle synthesis from the endoplasmic reticulum, promoting localized TAG production at specific ER subdomains.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Lipid droplet. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does S. pombe dga1 compare with orthologs from other species?

S. pombe dga1 is orthologous to diacylglycerol acyltransferases in various species, showing different degrees of sequence similarity:

SpeciesGene SymbolProtein IDNotable Features
Homo sapiens (human)MOGAT1NP_477513.2Monoacylglycerol acyltransferase activity
Mus musculus (mouse)Mogat1NP_080989.2Intestinal fat absorption
Saccharomyces cerevisiaeDGA1NP_014888.1Major DGAT enzyme in budding yeast
Eremothecium gossypiiAGOS_ACR140CNP_983542.1Related filamentous fungal ortholog
Kluyveromyces lactisKLLA0F11165gXP_455588.1Yeast ortholog
Schizosaccharomyces pombedga1XP_001713160.1Subject of this FAQ

The conservation pattern suggests functional significance across evolutionary lineages, particularly in organisms that synthesize and store triglycerides .

What expression systems yield optimal recombinant dga1 protein production?

The most effective expression system for producing functional recombinant S. pombe dga1 is E. coli. Commercial sources suggest specific approaches:

  • Expression conditions:

    • Host: E. coli BL21(DE3) or similar strains

    • Vector: pET series with His-tag (preferably N-terminal due to membrane topology)

    • Induction: 0.5 mM IPTG at 18°C for 16-20 hours (lower temperatures improve solubility)

    • Media: 2× YT media supplemented with appropriate antibiotics

  • Expression optimization:

    • Co-expression with chaperones (GroEL/GroES) can improve folding

    • Addition of 0.5% glucose to suppress basal expression before induction

    • Use of detergents (0.1% Triton X-100) during cell lysis helps solubilize the membrane-associated protein

Recombinant S. pombe dga1 is commercially available with His-tags, which facilitates purification while maintaining enzymatic activity .

What are effective methods for verifying dga1 activity after purification?

After purification, verification of dga1 activity is critical. Standard methods include:

  • Enzymatic activity assay:

    • Substrate preparation: diacylglycerol and acyl-CoA

    • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, 10 mM MgCl₂

    • Detection methods:

      • Radiometric assay using [¹⁴C]-labeled acyl-CoA

      • HPLC quantification of synthesized triacylglycerols

      • Fluorescent assay using NBD-labeled lipid substrates

  • Western blot detection:

    • Using anti-dga1 antibodies (polyclonal antibodies from rabbit are commercially available)

    • Expected molecular weight: approximately 38-40 kDa

  • Mass spectrometry verification:

    • Tryptic digest followed by LC-MS/MS to confirm protein identity

    • MALDI-TOF to verify intact protein mass

Maintaining the native conformation of dga1 is challenging due to its membrane association, requiring careful handling with appropriate detergents throughout the purification process .

How can recombinant dga1 be used to study triacylglycerol biosynthesis pathways?

Recombinant dga1 serves as a valuable tool for investigating triacylglycerol synthesis:

  • In vitro reconstitution studies:

    • Combining purified dga1 with defined lipid substrates allows precise measurement of enzymatic parameters (Km, Vmax, substrate specificity)

    • Artificial liposomes containing dga1 can mimic cellular environments for studying membrane-dependent activity

  • Inhibitor screening:

    • High-throughput assays using recombinant dga1 to identify compounds that modulate triacylglycerol synthesis

    • Structure-activity relationship studies of inhibitors provide insights into catalytic mechanism

  • Protein interaction studies:

    • Pull-down assays using tagged dga1 to identify interaction partners

    • Proximity labeling in S. pombe cells expressing modified dga1 (similar to TurboID method described for other S. pombe proteins)

    • Co-immunoprecipitation followed by mass spectrometry to identify protein complexes involving dga1

These approaches provide mechanistic insights into triacylglycerol synthesis regulation in yeast and potentially other eukaryotes .

What genetic approaches can be used to study dga1 function in S. pombe?

S. pombe offers powerful genetic tools for investigating dga1 function:

  • Knockout and complementation studies:

    • Generation of dga1Δ strains to assess phenotypic consequences

    • Complementation with wild-type or mutant dga1 variants to study structure-function relationships

    • Complementation with orthologs from other species to assess functional conservation

  • Genomic integration strategies:

    • Site-specific integration techniques to introduce tagged versions of dga1

  • Regulated expression systems:

    • nmt1 promoter series (strong, medium, weak) for thiamine-repressible expression

    • urg1 promoter system for faster induction (within 30 minutes) compared to nmt1 (14-20 hours)

  • Meiotic recombination assays:

    • Methods for analyzing the effects of lipid metabolism genes on meiotic processes

    • Both random spore and tetrad analysis approaches are well-established for S. pombe

Researchers can leverage the extensive genetic toolbox available for S. pombe, with approximately 70% of its genes having human orthologs, making findings potentially translatable to human biology .

How does dga1 contribute to lipid droplet formation and dynamics in S. pombe?

Dga1 plays a crucial role in lipid droplet biogenesis through several mechanisms:

  • Lipid droplet formation pathway:

    • Dga1 localizes to both the endoplasmic reticulum (ER) and lipid droplet (LD) surfaces

    • During LD biogenesis, dga1 generates triacylglycerols that accumulate between ER membrane leaflets

    • As lipid lenses grow, they eventually bud from the ER to form nascent LDs

    • Dga1 can subsequently relocate from the ER to the LD surface to continue TAG synthesis

  • Quantitative contribution to TAG synthesis:

    • In S. pombe, dga1 is responsible for approximately 40-50% of total cellular triacylglycerol synthesis

    • The remainder is synthesized by other enzymes including phospholipid:diacylglycerol acyltransferase (PDAT)

  • Regulation during nutrient stress:

    • During nitrogen starvation, dga1 expression and activity increase to promote TAG storage

    • Upon return to nutrient-rich conditions, LDs are mobilized for energy through lipase-mediated TAG hydrolysis

Advanced imaging techniques such as fluorescently tagged dga1 combined with LacO arrays at different genomic positions can be used to visualize dga1 dynamics in live cells .

What methods are available for studying post-translational modifications of dga1?

Post-translational modifications (PTMs) of dga1 represent an emerging area of research:

  • Mass spectrometry-based PTM mapping:

    • Enrichment strategies for phosphorylated, acetylated, or ubiquitinated dga1

    • Targeted multiple reaction monitoring (MRM) assays for quantifying specific modifications

    • Crosslinking mass spectrometry to identify interaction surfaces modified by PTMs

  • Genetic approaches for studying PTM-deficient variants:

    • Site-directed mutagenesis of predicted modification sites (Ser/Thr/Tyr for phosphorylation, Lys for acetylation/ubiquitination)

    • Integration of mutant variants into dga1Δ strains to assess functional consequences

  • Tools for manipulating cellular kinase/phosphatase pathways:

    • Chemical inhibitors of specific signaling pathways

    • Temperature-sensitive alleles of signaling components (e.g., cdc2asM17 ATP-analogue sensitive allele)

    • Genetic deletion or overexpression of specific kinases/phosphatases

Researchers should consider leveraging S. pombe's advantages as a model organism, including its well-characterized cell cycle, to study regulation of dga1 activity in response to environmental changes and developmental signals .

What are common challenges in working with recombinant dga1 and how can they be addressed?

Several technical challenges are commonly encountered when working with dga1:

  • Solubility and stability issues:

    • Challenge: As a membrane-associated protein, dga1 has limited solubility in aqueous buffers

    • Solution:

      • Use mild detergents (0.05-0.1% DDM, 0.5-1% CHAPS, or 0.01-0.05% LMNG)

      • Consider nanodiscs or amphipols for maintaining native conformation

      • Store with 20-50% glycerol at -80°C to prevent aggregation during freeze-thaw cycles

  • Activity loss during purification:

    • Challenge: Significant reduction in enzymatic activity often occurs during purification

    • Solution:

      • Minimize purification steps and processing time

      • Include lipid additives (0.01-0.05 mg/ml total liver lipid extract)

      • Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation of critical cysteine residues

  • Expression toxicity in host cells:

    • Challenge: Overexpression can be toxic to E. coli hosts

    • Solution:

      • Use tightly controlled expression systems (T7lac promoter with glucose repression)

      • Reduce induction temperature to 16-18°C

      • Consider specialized E. coli strains designed for membrane protein expression (C41/C43)

  • Substrate preparation difficulties:

    • Challenge: Diacylglycerol substrates have poor water solubility

    • Solution:

      • Prepare substrates in ethanol or DMSO (final concentration <2%)

      • Use mixed micelles with phospholipids or cyclodextrin carriers

      • Consider enzymatically generating substrates in situ using phospholipase C

These solutions have been optimized based on research experience with similar membrane-bound enzymes and can significantly improve experimental outcomes .

How can researchers design experiments to differentiate between dga1 and other acyltransferases?

Distinguishing dga1 activity from other acyltransferases requires careful experimental design:

  • Substrate specificity profiling:

    • Compare activity with various acyl-CoA chain lengths (C8-C22) and saturation states

    • Test alternative acyl donors (acyl-CoA vs. acyl-carnitine vs. phospholipids)

    • Assess diacylglycerol substrates with different fatty acid compositions and stereochemistry

  • Inhibitor panels for differentiation:

    • DGAT1 inhibitors (e.g., T863) vs. DGAT2 family inhibitors

    • Phospholipid synthesis inhibitors to rule out indirect effects

    • Species-specific inhibitor responses can help distinguish between paralogs

  • Genetic approaches in S. pombe:

    • Create strains with specific acyltransferase deletions:

      • Single: dga1Δ

      • Double: dga1Δ + other acyltransferases

    • Measure residual TAG synthesis to determine relative contributions

    • Complementation with heterologous enzymes to assess functional conservation

  • Subcellular localization studies:

    • Use fluorescent protein tagging to visualize distinct localization patterns

    • Apply subcellular fractionation followed by enzymatic assays

    • Perform protease protection assays to determine membrane topology

These approaches, combined with careful controls, allow researchers to attribute observed activities specifically to dga1 rather than related enzymes or non-enzymatic reactions .

How might structural studies of dga1 advance our understanding of acyltransferase mechanisms?

Structural characterization of dga1 represents a significant frontier in understanding triacylglycerol synthesis:

  • Current structural knowledge gaps:

    • No high-resolution structure exists for any member of the DGAT2 family

    • Membrane integration topology remains partially characterized

    • Substrate binding sites and catalytic residues are predicted but not confirmed

  • Promising structural biology approaches:

    • Cryo-electron microscopy with lipid nanodiscs

    • X-ray crystallography of soluble domains

    • Integrative modeling combining crosslinking mass spectrometry, EPR, and computational prediction

    • AlphaFold and other AI-based prediction methods for generating testable structural models

  • Structure-guided enzyme engineering potential:

    • Rational design of dga1 variants with altered substrate specificity

    • Creation of chimeric enzymes with properties from multiple species

    • Development of biosensors by integrating dga1 domains with fluorescent reporters

Structural information would significantly accelerate understanding of both S. pombe and human diacylglycerol acyltransferases, potentially informing therapeutic development for metabolic disorders .

What are the implications of dga1 research for understanding human DGAT enzymes and metabolic disorders?

Research on S. pombe dga1 has several translational implications:

  • Evolutionary conservation and divergence:

    • S. pombe dga1 shares significant sequence similarity with human MOGAT1/DGAT2 family

    • Conserved functional domains provide insight into essential catalytic mechanisms

    • Differences highlight species-specific adaptations in lipid metabolism

  • Model system advantages for therapeutic development:

    • S. pombe genetic manipulation is simpler than mammalian systems

    • High-throughput screening capabilities for identifying DGAT modulators

    • Reconstituted enzyme systems for detailed biochemical characterization

  • Potential biomedical applications:

    • Triglyceride synthesis inhibitors for metabolic disorders

    • Understanding rare genetic diseases involving acyltransferase deficiencies

    • Engineering yeast strains for production of specialized lipids for pharmaceutical applications

  • Comparative biology insights:

    • Differing regulation of dga1 orthologs across species provides insight into metabolic adaptations

    • Conservation of protein-protein interactions suggests key regulatory mechanisms

    • Species-specific PTM patterns may explain metabolic differences

The high proportion (approximately 70%) of S. pombe genes with human orthologs makes findings particularly relevant to human biology, offering translational potential for metabolic research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.