Recombinant Schizosaccharomyces pombe Dihydroceramide delta (4)-desaturase

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Gene and Protein Details

  • Gene name: dsd1 (SPBC32F12.01c) .

  • Function: Dihydroceramide Δ4-desaturase (EC 1.14.-.-) .

  • Host systems: Recombinant protein is expressed in E. coli, yeast, baculovirus, or mammalian cells with ≥85% purity .

Catalytic Mechanism

  • Requires cytochrome b₅ (mb5) and NADH for electron transfer during hydroxylation .

  • Substrate specificity: Prefers dihydroceramide over sphinganine .

  • Kinetic parameters (mouse homolog, Des2) :

    ParameterValue
    Kₘ (substrate)35 µM (N-octanoylsphinganine)
    Vₘₐₓ40 nmol·h⁻¹·mg⁻¹
    Kₘ (mb5)0.8 µM

Functional Role in Sphingolipid Metabolism

Dsd1 catalyzes the final step in ceramide biosynthesis, converting dihydroceramide to ceramide. This reaction is critical for producing sphingosine, a precursor for signaling molecules like sphingosine-1-phosphate . Key findings include:

  • Non-essentiality in S. pombe: Gene disruption does not affect viability, suggesting sphingosine is dispensable in fission yeast .

  • Plant homologs: Arabidopsis Δ4-desaturase (At4g04930) restores glucosylceramide synthesis in Pichia pastoris mutants, highlighting functional conservation .

A. In Vitro Reconstitution

  • Purified recombinant Dsd1 (tagged with FLAG) requires mb5 and NADH for activity .

  • Membrane-bound cytochrome b₅ is essential; soluble forms fail to support catalysis .

Subcellular Localization

  • Localizes to the endoplasmic reticulum, interacting with mb5 via transmembrane domains .

Phenotypic Analysis

  • Knockout mutants: No growth defects in S. pombe, but floral tissues of Arabidopsis mutants show reduced glucosylceramide levels .

Comparative Analysis with Homologs

FeatureS. pombe Dsd1Mouse Des2
ActivityΔ4-desaturationBifunctional (Δ4-desaturase/C-4-hydroxylase)
Tissue specificityUbiquitousSmall intestine, kidney
EssentialityNon-essential Essential for phytoceramide synthesis

Applications in Research

  • Tool for sphingolipid studies: Used to investigate ceramide’s role in apoptosis and stress signaling .

  • Heterologous expression: Enables functional characterization of desaturases in yeast systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
dsd1; SPBC3B8.07c; Sphingolipid delta(4-desaturase; Delta 4-(E-sphingolipid desaturase; Dihydroceramide desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
dsd1
Target Protein Sequence
MAESTATTTAVPPPAEESWNADSEDVHQFYWTYTEEPHKSRRAAILKAHPEIASLNGYEP LTKWIVLGVVSLQFTCAYLLSQSSLLSWKFFLTAYFIGAFCNQNLFLAIHELSHNLGFKK TLYNRAYCLFANLPVGAPFAASFRPYHMEHHAYQGVDGMDTDLPTRAELILFDNVLGKAF FCTFQLLFYAFRPLVVRRLPFTLMHFWNIIVQFSFDYLVVRYVGWRALAYFFMSSFLAGS LHPTAGHFLSEHYNMTRTRLIASGPGKETPLETFSYYGPLNFFVYNAGYHIEHHDFPYVA WTRIGKVRELAPEFYDNIPDCKSWCGIIYQFITDSNVGMWCRVKRKQKHADIPTKSMHLH VS
Uniprot No.

Target Background

Function
Delta(4)-fatty-acid desaturase introduces a double bond at the 4-position in the long-chain base (LCB) of ceramides. This enzyme plays a crucial role in sphingosine biosynthesis.
Database Links
Protein Families
Fatty acid desaturase type 1 family, DEGS subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is dihydroceramide delta(4)-desaturase and what is its role in S. pombe?

Dihydroceramide delta(4)-desaturase belongs to a family of desaturase-like polypeptide sequences found in many higher eukaryotes. In S. pombe, the gene designated SDCB3b8.07c encodes this enzyme, which is responsible for the synthesis of sphingosine through the introduction of a double bond at the delta(4) position of dihydroceramide . This enzyme represents an important component of the sphingolipid biosynthetic pathway, which produces molecules crucial for membrane structure and cellular signaling.

Is dihydroceramide delta(4)-desaturase essential for S. pombe viability?

Surprisingly, homologous recombination studies have demonstrated that disruption of the endogenous S. pombe dihydroceramide delta(4)-desaturase has no effect on cell viability . This finding is significant because it indicates that sphingosine, the product of this enzymatic reaction, may not be crucial for normal S. pombe cellular functions. This contrasts with many other eukaryotes where sphingolipids are essential and has important implications for our understanding of sphingolipid metabolism in lower eukaryotes .

What expression systems are suitable for producing recombinant S. pombe dihydroceramide delta(4)-desaturase?

While not explicitly detailed in the search results, the approach to expressing membrane-bound desaturases would be similar to other integral membrane proteins. Heterologous expression systems for membrane proteins often include yeast (such as S. cerevisiae), insect cells (using baculovirus expression systems), or mammalian cell lines. For functional studies, it's often advantageous to express the enzyme in a host that lacks endogenous dihydroceramide desaturase activity to avoid background activity. Purification typically involves detergent solubilization followed by affinity chromatography using epitope tags engineered into the recombinant protein.

How does the subcellular localization of dihydroceramide delta(4)-desaturase compare to other lipid desaturases in yeast?

While the search results don't specifically address the localization of dihydroceramide delta(4)-desaturase, studies on the acyl chain desaturase Ole1p in yeast provide a relevant comparison. Ole1p normally exhibits a uniform distribution throughout the ER, but upon inactivation, it relocalizes to a more punctuate pattern at the cell periphery . This relocalization occurs within minutes under nonpermissive conditions and is fully reversible . It would be valuable to investigate whether the dihydroceramide delta(4)-desaturase shows similar behavior. Given that both enzymes modify lipids, they might share regulatory mechanisms that control their subcellular distribution in response to changes in lipid composition or environmental conditions.

What are the structural determinants of substrate specificity in S. pombe dihydroceramide delta(4)-desaturase?

This advanced question involves understanding which amino acid residues or protein domains determine the enzyme's preference for dihydroceramide substrates and the regioselectivity of the desaturation reaction. While not directly addressed in the search results, approaches to answering this question would include comparative analysis with other desaturases, site-directed mutagenesis of conserved residues, and potentially protein structural studies. The ability of S. pombe to survive without this enzyme provides an excellent experimental system for structure-function studies, as mutations can be introduced without concerns about lethality.

How does temperature affect the activity and stability of recombinant S. pombe dihydroceramide delta(4)-desaturase?

Temperature is a critical factor affecting membrane fluidity and the activity of membrane-associated enzymes. In studies of other lipid-modifying enzymes, temperature affects both enzyme activity and subcellular localization . For researchers working with recombinant dihydroceramide delta(4)-desaturase, it's important to consider how experimental temperature might influence enzyme behavior. The search results indicate that heat stress at 40°C significantly alters membrane properties in S. pombe , which would likely influence the environment in which the desaturase functions. Temperature optimization would be an important parameter when developing activity assays for the recombinant enzyme.

What compensatory mechanisms exist in S. pombe to maintain membrane homeostasis in the absence of dihydroceramide delta(4)-desaturase?

Given that S. pombe can survive without dihydroceramide delta(4)-desaturase , the cell must have alternative mechanisms to maintain membrane homeostasis. These might include adjustments in other lipid biosynthetic pathways, alterations in fatty acid desaturation patterns, or changes in sterol content. For example, under heat stress conditions, wild-type S. pombe cells increase their triacylglycerol levels, which helps manage membrane fluidity by removing unsaturated fatty acids from membrane lipids . In cells lacking dihydroceramide delta(4)-desaturase, similar or distinct compensatory mechanisms might be employed to maintain proper membrane properties in the absence of certain sphingolipid species.

What are the optimal methods for measuring dihydroceramide delta(4)-desaturase activity in vitro?

Measuring the activity of membrane-bound desaturases requires careful consideration of the lipid environment and substrate presentation. An effective approach would involve preparing membrane fractions or purified enzyme reconstituted in liposomes, then introducing dihydroceramide substrates. The reaction products (ceramides containing the delta(4) double bond) could be analyzed by liquid chromatography-mass spectrometry (LC-MS). The search results don't provide specific details for dihydroceramide delta(4)-desaturase, but studies of other desaturases like Ole1p suggest that enzyme activity is highly dependent on the lipid environment . Therefore, the composition of artificial membranes used in such assays would be critical for obtaining physiologically relevant results.

How can researchers effectively distinguish between direct and indirect effects when studying S. pombe dihydroceramide delta(4)-desaturase function?

This methodological challenge requires careful experimental design. One approach is to use acute inhibition rather than genetic knockout to observe immediate effects before compensatory mechanisms take effect. Time-course experiments comparing early versus late responses after enzyme inhibition can help distinguish primary from secondary effects. Additionally, complementation experiments, where the native enzyme is replaced with variants having altered activity, can provide insights into direct functional consequences. The comparison of lipid profiles between wild-type and knockout strains under various conditions (e.g., different temperatures or stress states) can also help identify specific lipid changes directly attributable to the desaturase activity.

What techniques are most effective for studying the membrane topology of dihydroceramide delta(4)-desaturase?

Understanding the membrane topology of integral membrane proteins like dihydroceramide delta(4)-desaturase is crucial for structure-function studies. Effective approaches include:

  • Protease protection assays, where membranes containing the enzyme are treated with proteases that can only access cytosolic domains

  • Site-directed chemical labeling with membrane-impermeable reagents

  • Insertion of epitope tags at various positions followed by immunofluorescence in permeabilized versus non-permeabilized cells

  • Glycosylation mapping, where potential glycosylation sites are introduced and their modification status indicates luminal localization

These approaches could be combined to develop a comprehensive model of how the enzyme is oriented within the ER membrane, which would inform understanding of its catalytic mechanism.

How should researchers interpret changes in sphingolipid profiles in S. pombe strains with altered dihydroceramide delta(4)-desaturase expression?

Interpreting lipidomic data requires careful consideration of both direct and indirect effects. When analyzing sphingolipid profiles in wild-type versus desaturase-deficient strains, researchers should:

  • Distinguish between substrate accumulation (direct effect) and compensatory changes in other lipid classes (indirect effect)

  • Consider potential feedback inhibition or activation of other enzymes in the sphingolipid pathway

  • Examine ratios of related lipids rather than absolute concentrations

  • Account for potential changes in total membrane lipid content

The search results indicate that lipid metabolism in S. pombe is highly adaptive, as seen in the response to heat stress . Similar adaptations likely occur when sphingolipid metabolism is perturbed through manipulation of dihydroceramide delta(4)-desaturase, complicating data interpretation.

What controls are necessary when evaluating membrane fluidity changes in dihydroceramide delta(4)-desaturase mutants?

Membrane fluidity assessments require rigorous controls, especially when studying the effects of lipid-modifying enzymes. Based on approaches used for studying other aspects of membrane fluidity in S. pombe , researchers should:

  • Include temperature controls, as membrane fluidity is highly temperature-dependent

  • Compare multiple membrane regions or organelles, as effects may be localized

  • Use complemented strains (knockout strains with reintroduced wild-type enzyme) to confirm that observed effects are specifically due to the absence of desaturase activity

  • Consider the use of multiple fluidity probes that preferentially partition into different membrane domains

The search results describe methods for assessing membrane order using fluorescent probes like di-4 ANEPPDHQ, which can detect differences in membrane packing between wild-type and lipid metabolism mutants .

How can discrepancies in phenotypic data between different studies of S. pombe dihydroceramide delta(4)-desaturase be reconciled?

When faced with conflicting results across studies, researchers should:

  • Carefully compare experimental conditions, including growth media, temperature, cell density, and growth phase

  • Consider strain background differences that might influence compensatory mechanisms

  • Examine the specific methods used for gene disruption or protein inhibition

  • Evaluate the sensitivity and specificity of the phenotypic assays employed

The search results indicate that even mild temperature changes can significantly affect membrane properties in S. pombe , highlighting how seemingly minor differences in experimental conditions could lead to substantial phenotypic differences between studies.

How does the function of dihydroceramide delta(4)-desaturase in S. pombe compare to homologous enzymes in other fungal species?

Comparative studies between fungal species can provide valuable insights into the evolution and functional diversity of sphingolipid metabolism. The search results indicate significant differences in lipid metabolism between the related fission yeasts S. pombe and S. japonicus . While S. pombe has a delta-9 desaturase (Ole1), S. japonicus possesses both delta-9 and delta-12 desaturases, resulting in detectable polyunsaturated glycerophospholipids that are absent in S. pombe . Similar species-specific variations likely exist in dihydroceramide desaturase function and regulation. Future studies comparing enzyme activity, substrate specificity, and cellular roles across fungal species could reveal evolutionary adaptations in sphingolipid metabolism.

What potential exists for engineering S. pombe dihydroceramide delta(4)-desaturase for biotechnological applications?

The non-essential nature of dihydroceramide delta(4)-desaturase in S. pombe makes it an attractive target for protein engineering without compromising cell viability. Potential biotechnological applications include:

  • Engineering the enzyme to accept modified substrates for producing novel sphingolipids with pharmaceutical applications

  • Developing biosensors for monitoring lipid metabolism in living cells

  • Creating strains with altered membrane properties for enhanced stress tolerance

The relocalization behavior observed with the Ole1p desaturase suggests that lipid desaturases may have evolved mechanisms to respond to changes in their lipid environment, which could be exploited in engineered systems.

How might the study of S. pombe dihydroceramide delta(4)-desaturase inform therapeutic approaches targeting sphingolipid metabolism?

Understanding the fundamental biology of dihydroceramide delta(4)-desaturase in model organisms like S. pombe can inform therapeutic strategies. The search results show that this enzyme is non-essential in S. pombe , which differs from the situation in some pathogenic fungi and human cells. These differences could potentially be exploited for developing selective antifungal or anticancer agents targeting dihydroceramide desaturase. Additionally, the relationship between sphingolipid metabolism and stress responses observed in yeast may have parallels in human diseases involving dysregulated sphingolipid metabolism, such as certain neurodegenerative disorders and metabolic diseases.

What approaches can be used to investigate the interaction between dihydroceramide delta(4)-desaturase and other enzymes in the sphingolipid pathway?

Protein-protein interactions involving membrane proteins like dihydroceramide delta(4)-desaturase require specialized techniques. Researchers might consider:

  • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to the desaturase in living cells

  • Split fluorescent protein complementation to visualize interactions in situ

  • Co-immunoprecipitation using mild detergents that preserve membrane protein interactions

  • Genetic interaction screens to identify functional relationships with other enzymes

The search results don't specifically address interactions between dihydroceramide delta(4)-desaturase and other proteins, but the observed relocalization of Ole1p desaturase suggests that membrane-bound desaturases may participate in dynamic protein complexes that reorganize in response to changes in enzymatic activity or lipid environment.

Table 1: Comparison of Experimental Approaches for Studying Recombinant S. pombe Dihydroceramide Delta(4)-Desaturase

Experimental ApproachAdvantagesLimitationsKey Considerations
Gene knockout/disruptionEliminates enzyme function completely; allows study of viability and compensatory mechanismsMay trigger extensive adaptive responses; does not allow temporal controlConfirmed to be viable in S. pombe ; allows clean genetic background for complementation studies
Conditional expressionAllows temporal control of enzyme levels; minimizes adaptive responsesLeaky expression may complicate interpretation; requires specific genetic toolsUseful for distinguishing immediate versus adaptive responses to loss of enzyme activity
Fluorescent protein taggingEnables visualization of enzyme localization and dynamicsTag may interfere with enzyme function; overexpression can cause artifactsCan investigate potential relocalization similar to that observed for Ole1p
In vitro reconstitutionAllows precise control of lipid environment and substrate concentrationMay not recapitulate in vivo regulation; challenging for membrane proteinsCritical for detailed kinetic and substrate specificity studies
Lipidomic analysisProvides comprehensive view of changes in sphingolipid profilesComplex data interpretation; requires sophisticated analytical toolsShould examine multiple lipid classes to identify compensatory changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.