Recombinant Schizosaccharomyces pombe ER-derived vesicles protein 41 (erv41)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate any format preferences in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
erv41; SPBC2G5.04c; ER-derived vesicles protein 41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erv41
Target Protein Sequence
MLRSRVPANIRAFDAFPKFSKEYRRQSSSRGGFFTILLSVLIVVLVFSQCVQYIRGIREQ ELFIYDSVSELMDLNIDITIAMPCSNLRIDVVDRTKDLVLATEALTLEEAFIKDMPTSST IYKNDRYAGLRWARTEKFRKKNNAEPGSGTACRIYGQLVVNRVNGQLHITAPGWGYGRSN IPFHSLNFTHYIEELSFGEYYPALVNALDGHYGHANDHPFAFQYYLSVLPTSYKSSFRSF ETNQYSLTENSVVRQLGFGSLPPGIFIDYDLEPLAVRVVDKHPNVASTLLRILAISGGLI TVASWIERVYSSRAHRSTSEADMLGLLGKSETE
Uniprot No.

Target Background

Function
Recombinant Schizosaccharomyces pombe ER-derived vesicles protein 41 (erv41) is a constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. It is essential for efficient transport of specific secretory proteins to the Golgi apparatus and facilitates retrograde transport from the Golgi back to the endoplasmic reticulum.
Database Links
Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Erv41 in Schizosaccharomyces pombe?

Erv41 functions as part of the Erv41-Erv46 complex, which serves as a retrograde receptor for the retrieval of non-HDEL-bearing endoplasmic reticulum (ER) resident proteins that have escaped to the Golgi apparatus. This complex recognizes specific cargo proteins in Golgi compartments and facilitates their return to the ER via COPI-formed transport carriers. The complex is critical for maintaining the proper localization of certain ER resident proteins, including glucosidase I (Gls1) and the prolyl-isomerase Fpr2, which would otherwise be mislocalized and potentially degraded in the vacuole . The Erv41-Erv46 complex is highly conserved across species and predominantly localizes to the ER-Golgi intermediate compartment and early Golgi compartments, similar to KDEL receptors but operating through a distinct mechanism .

How is Erv41 structurally characterized, and what domains are functionally important?

The Erv41 protein contains a luminal domain with an unusual β-sandwich arrangement and a prominent negative electrostatic surface patch that is thought to promote protein-protein interactions . This structural feature is likely crucial for recognizing and binding to specific ER resident proteins. The bulk of the Erv41 mass faces the ER lumen, making it well-positioned to interact with soluble luminal proteins. Additionally, the Erv41-Erv46 complex contains cytoplasmic tail sequences with COPI and COPII sorting signals that are essential for cycling between ER and Golgi compartments . In particular, Erv46 contains a conserved dilysine motif on its C-terminal tail, which is important for packaging into retrograde-directed COPI vesicles .

How does the deletion of Erv41 affect cellular proteome composition?

Quantitative proteomics using Stable Isotope Labeling by Amino Acids in Culture (SILAC) has revealed that deletion of Erv41 (erv41Δ) or Erv46 (erv46Δ) results in significant reductions in the levels of at least 20 proteins compared to wild-type cells . Most notably:

ProteinLog2 Ratio in erv41ΔLog2 Ratio in erv46ΔFunction
Gls1-1.19-1.40Glucosidase I, ER enzyme
Erv41-3.87N/AComponent of Erv41-Erv46 complex
Erv46N/A-4.41Component of Erv41-Erv46 complex
Fpr2ReducedReducedProlyl-isomerase
Msc1ReducedReducedER resident protein
Vps62ReducedReducedER resident protein
Jem1ReducedReducedER resident protein
Cpr4ReducedReducedER resident protein

These reductions indicate that the Erv41-Erv46 complex plays a crucial role in maintaining proper levels of specific ER resident proteins, likely through its retrieval function .

What are the most effective approaches for studying Erv41 trafficking between ER and Golgi compartments?

To study Erv41 trafficking, researchers should employ multiple complementary approaches:

  • In vitro COPII vesicle budding assays: These can determine the packaging efficiency of Erv41 into COPII vesicles. Prepare ER microsomes from wild-type and mutant strains and incubate them with purified COPII components (Sar1, Sec23/24, Sec13/31) plus GTP. After incubation, separate vesicles from donor membranes by centrifugation and analyze protein content by immunoblotting .

  • Co-immunoprecipitation (Co-IP) experiments: These can identify interaction partners of Erv41. Generate strains expressing epitope-tagged versions of Erv41 and potential cargo proteins. Prepare cell lysates under mild detergent conditions and perform immunoprecipitation using antibodies against the epitope tags. Analyze precipitated proteins by SDS-PAGE and immunoblotting .

  • Fluorescence microscopy with GFP-tagged proteins: This can visualize the subcellular localization of Erv41 and potential cargo proteins. Construct strains expressing Erv41-GFP or other fluorescently tagged proteins of interest. Use confocal microscopy to track their localization in live cells or after fixation and counterstaining with markers for different organelles .

  • Mutation of trafficking motifs: Generate point mutations in the COPI or COPII binding motifs of Erv41 or Erv46 (e.g., Erv46 KK/RR mutation) to disrupt specific trafficking steps and observe the effects on cargo localization .

How can researchers effectively produce and purify recombinant Erv41 for structural and functional studies?

For optimal production and purification of recombinant Erv41 from S. pombe, the following methodological approach is recommended:

  • Expression system selection: Use either the native S. pombe system or heterologous expression in E. coli or insect cells. For structural studies, expression of the luminal domain alone may be sufficient and easier to produce.

  • Construct design: Include an appropriate affinity tag (His6, GST, or TAP tag) for purification. Consider including a cleavable signal sequence if expressing in E. coli.

  • Purification protocol:

    • Lyse cells in a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, and protease inhibitors

    • Clarify lysate by centrifugation at 100,000 × g for 1 hour

    • Purify using affinity chromatography based on the chosen tag

    • Further purify by size-exclusion chromatography

    • For structural studies, concentrate to 5-10 mg/ml in a buffer containing 20 mM HEPES pH 7.0, 150 mM NaCl

  • Quality control: Assess purity by SDS-PAGE and protein folding by circular dichroism spectroscopy. For the Erv41 luminal domain, verify the characteristic β-sandwich structure .

  • Functional verification: Test the purified protein's ability to bind known cargo proteins (e.g., Gls1) in a pH-dependent manner using pull-down assays or surface plasmon resonance.

What methods are most suitable for identifying new cargo proteins that depend on the Erv41-Erv46 complex for proper localization?

Multiple complementary approaches can be employed to identify new cargo proteins:

  • Quantitative proteomics (SILAC): Compare protein abundance between wild-type and erv41Δ or erv46Δ strains. Proteins significantly reduced in the mutant strains are potential cargo candidates. This approach has successfully identified Gls1, Fpr2, Msc1, Vps62, Jem1, and Cpr4 as potential cargo proteins .

  • Secretome analysis: Collect and analyze the extracellular medium from wild-type and erv41Δ cultures to identify proteins that are secreted in the absence of Erv41.

  • Microscopy-based screens: Generate a library of GFP-tagged ER resident proteins and monitor their localization in wild-type versus erv41Δ backgrounds.

  • Affinity purification coupled with mass spectrometry: Use tagged versions of Erv41 and Erv46 to pull down interacting proteins under conditions that favor cargo binding (pH ~6.0).

  • Bioinformatic approaches: Once a sorting motif is identified (e.g., from analyzing the 118-amino acid Fpr2 protein), perform genome-wide searches for proteins containing similar motifs .

In the case of the Erv41-Erv46 complex, pH-dependent binding is a key feature to consider in experimental design, as the complex binds cargo in the mildly acidic environment of Golgi compartments and releases it in the neutral pH of the ER lumen .

How does pH regulate the cargo binding and release cycle of the Erv41-Erv46 complex?

The Erv41-Erv46 complex exhibits pH-dependent binding to its cargo proteins, which is a crucial mechanism for its function as a retrograde receptor. Research has shown:

  • pH-dependent binding mechanism: Pull-down and co-immunoprecipitation experiments demonstrate that the interaction between the Erv41-Erv46 complex and cargo proteins like Gls1 is regulated by pH. The complex preferentially binds cargo at mildly acidic pH (pH ~6.0), typical of early Golgi compartments, and releases cargo at neutral pH (pH ~7.2), characteristic of the ER lumen .

  • Experimental evidence: When cellular pH gradients are disrupted using bafilomycin A1, a vacuolar H+-ATPase inhibitor that neutralizes acidic compartments, Gls1 is mislocalized and secreted from cells. This provides strong evidence that the pH gradient between the ER and Golgi is essential for proper cargo retrieval by the Erv41-Erv46 complex .

  • Structural basis: The luminal domain of Erv41 contains a prominent negative electrostatic surface patch that likely mediates pH-dependent interactions with cargo proteins . At lower pH, protonation of key residues may alter the electrostatic properties of this interaction surface, enabling cargo binding.

  • Proposed model: In this model, escaped ER resident proteins like Gls1 bind to the Erv41-Erv46 complex in the reduced pH environment of early Golgi compartments. The complex with bound cargo is then packaged into COPI vesicles for retrograde transport to the ER. Upon arrival in the neutral pH environment of the ER, the cargo is released from the complex .

How do mutations in the COPI binding motif of Erv46 affect cargo trafficking and cellular phenotypes?

Mutations in the COPI binding motif of Erv46, particularly the conserved dilysine motif on its C-terminal tail, have significant effects on cargo trafficking:

  • Effect on Erv46 localization: Mutation of the dilysine motif to diarginines (Erv46 KK/RR) disrupts binding to the COPI complex, which impairs retrograde transport of the Erv41-Erv46 complex from the Golgi to the ER. This results in the accumulation of the complex in post-ER compartments .

  • Impact on cargo localization: In strains expressing the Erv46 KK/RR mutant, the steady-state cellular levels of Gls1 are reduced by approximately 30% compared to wild-type strains. Additionally, Gls1 is abnormally secreted to the extracellular medium, indicating failure of the retrieval mechanism .

  • Partial phenotype: Interestingly, the phenotype of the Erv46 KK/RR mutant is not as severe as the complete deletion of erv41 or erv46, suggesting that partially redundant COPI sorting information may remain in the point mutant .

  • Cellular consequences: The improper localization of ER resident proteins like Gls1 due to defects in the Erv41-Erv46 retrieval system can lead to various cellular defects, potentially affecting protein folding, quality control, and glycoprotein processing in the ER.

This evidence strongly supports the model that the Erv41-Erv46 complex functions as a retrograde receptor that requires proper COPI-mediated trafficking for efficient retrieval of its cargo proteins.

What is the relationship between the Erv41-Erv46 complex and other retrograde trafficking pathways in S. pombe?

The Erv41-Erv46 complex represents a distinct retrograde trafficking pathway in S. pombe that complements other known retrieval mechanisms:

  • Comparison with KDEL/HDEL receptor system:

    • The Erv41-Erv46 complex retrieves soluble ER-luminal proteins that do not contain KDEL/HDEL signals, making it functionally distinct from the seven-transmembrane KDEL receptor .

    • While both systems cycle between ER and Golgi and use pH-dependent binding, they recognize different classes of cargo proteins through different binding motifs.

    • Both localize predominantly to the ER-Golgi intermediate compartment and early Golgi compartments .

  • Relationship with Rer1-dependent retrieval:

    • Rer1 mediates retrieval of certain ER membrane proteins via recognition of specific transmembrane domains.

    • The Erv41-Erv46 complex retrieves soluble luminal proteins, suggesting complementary rather than overlapping functions.

  • Integration with COPI machinery:

    • Both the KDEL receptor and the Erv41-Erv46 complex utilize COPI vesicles for retrograde transport.

    • The dilysine motif in Erv46 interacts with the COPI coat in a manner similar to other COPI cargo adaptors .

  • Potential interactions with quality control pathways:

    • Retrieved cargo proteins like Gls1 and Fpr2 are involved in protein folding and quality control in the ER.

    • Failure of retrieval leads to degradation of these proteins in the vacuole, suggesting a possible interaction with the secretory protein quality control system.

Understanding how these different retrieval pathways coordinate to maintain ER homeostasis remains an active area of research.

How is the expression and activity of Erv41 regulated in response to cellular stress conditions?

While specific information about stress-dependent regulation of Erv41 in S. pombe is limited in the provided search results, several potential regulatory mechanisms can be inferred:

  • ER stress response: Since Erv41 functions in maintaining ER resident protein localization, its expression might be regulated as part of the unfolded protein response (UPR). Notably, deletion strains for certain anterograde cargo receptors display an activated UPR, but erv41Δ and erv46Δ strains do not show this phenotype , suggesting a more specialized role in ER homeostasis.

  • Calcium homeostasis: The retrieval function of the Erv41-Erv46 complex appears to be related to calcium homeostasis in some capacity. Several cargo proteins depend on the complex for localization, and perturbation of calcium levels by overexpression of Pck2 (a protein kinase C homologue) induces an extremely high intracellular calcium concentration in S. pombe . This suggests potential regulatory crosstalk between calcium signaling and Erv41-Erv46 function.

  • Cell cycle regulation: In S. pombe, certain trafficking pathways are regulated during the cell cycle. Given the importance of ER function during cell division, Erv41-Erv46 activity might be modulated during different cell cycle phases, though direct evidence for this is not provided in the search results.

A systematic analysis of Erv41 expression and localization under different stress conditions (e.g., ER stress, calcium depletion, oxidative stress) would be valuable for understanding its regulatory mechanisms.

What is the impact of Erv41 deletion on other cellular processes besides protein trafficking?

Deletion of Erv41 (erv41Δ) has several consequences beyond direct effects on protein trafficking:

  • Protein glycosylation: Defects in the localization of ER-resident proteins in erv41Δ cells can affect protein glycosylation. For example, the acid phosphatase in Erv41-deficient cells shows increased electrophoretic mobility, suggesting incomplete protein glycosylation .

  • Cell wall integrity: Although not directly linked to Erv41 in the search results, proper localization of ER-resident proteins is important for cell wall synthesis. In S. pombe, 1,3-β-d- and 1,3-α-d-glucan synthases contribute to the mechanical strength of the cell wall, and their activities can be affected by mislocalization of proteins involved in their regulation or post-translational modification .

  • Vesicle fusion efficiency: In erv41Δ and erv46Δ mutants, a modest reduction in the apparent fusion of COPII vesicles with Golgi membranes was observed in cell-free transport reactions . This effect may be indirect, resulting from inefficient ER export of proteins necessary for fusion at Golgi membranes or for glycosylation of cargo proteins that serve as readouts for fusion in cell-free assays.

  • Protein quality control: Since certain ER-resident proteins involved in protein folding (like Gls1 and Fpr2) are mislocalized in erv41Δ cells, there may be broader effects on protein quality control mechanisms, potentially affecting the folding and maturation of secretory and membrane proteins .

How does S. pombe Erv41 differ from its homologs in other organisms, particularly S. cerevisiae?

The Erv41 protein is highly conserved across species, but there are notable differences between S. pombe Erv41 and its homologs in other organisms:

Further comparative studies using complementation experiments (expressing Erv41 from different species in S. pombe erv41Δ cells) would provide valuable insights into functional conservation and divergence across species.

How do the cargo recognition mechanisms of the Erv41-Erv46 complex compare to other retrograde trafficking receptors?

The Erv41-Erv46 complex employs unique cargo recognition mechanisms that distinguish it from other retrograde trafficking receptors:

  • Comparison with KDEL/HDEL receptor:

    • Signal sequence: The KDEL receptor recognizes a specific C-terminal tetrapeptide sequence (KDEL or HDEL) on its cargo proteins. In contrast, the Erv41-Erv46 complex appears to recognize a different sorting motif that has not yet been fully characterized .

    • Structural basis: The KDEL receptor is a seven-transmembrane protein, while the Erv41-Erv46 complex has a different architecture with the bulk of its mass facing the ER lumen .

    • pH dependence: Both systems use pH differences between ER and Golgi to regulate cargo binding and release, but likely through different molecular mechanisms .

  • Comparison with Rer1:

    • Cargo type: Rer1 primarily retrieves membrane proteins with specific transmembrane domains, while the Erv41-Erv46 complex retrieves soluble luminal proteins .

    • Recognition mechanism: Rer1 recognizes polar residues within transmembrane domains, whereas the Erv41-Erv46 complex likely recognizes features of folded luminal domains.

  • Unique features of Erv41-Erv46:

    • The complex appears to recognize a class of ER resident proteins through a novel interaction motif, potentially related to the negative electrostatic surface patch on the Erv41 luminal domain .

    • The 118-amino acid Fpr2 protein is being used to define this sorting motif, which may permit bioinformatic searches for other potential cargo proteins .

This diversity in cargo recognition mechanisms ensures that cells can efficiently retrieve different classes of proteins that have escaped from the ER, maintaining proper organelle composition under dynamic conditions.

What experimental systems beyond S. pombe can be used to study Erv41 function?

Several experimental systems can provide complementary insights into Erv41 function:

  • Saccharomyces cerevisiae:

    • Advantages: Well-established genetic tools, available genome-wide deletion and GFP-tagged strain collections.

    • Applications: Comparative studies of cargo recognition, structure-function analysis through chimeric proteins, synthetic genetic interaction screens.

  • Mammalian cell culture systems:

    • Advantages: Closer relevance to human disease, complex tissue-specific trafficking pathways.

    • Applications: Studies of human ERGIC1/ERGIC2 (Erv41/Erv46 homologs), potential connections to diseases involving ER protein mislocalization.

  • In vitro reconstitution systems:

    • Advantages: Precise control of components and conditions, direct assessment of biochemical activities.

    • Applications: Reconstitution of cargo binding and release using purified components, studies of pH-dependent binding mechanisms.

  • Structural biology approaches:

    • Advantages: Atomic-level insights into protein interactions and conformational changes.

    • Applications: Crystal or cryo-EM structures of the Erv41-Erv46 complex alone and in complex with cargo proteins.

  • Computational modeling:

    • Advantages: Integration of diverse experimental data, prediction of interaction motifs.

    • Applications: Molecular dynamics simulations of pH-dependent binding, prediction of additional cargo proteins based on identified sorting motifs.

Combining these diverse experimental systems can provide a comprehensive understanding of Erv41 function across evolutionary space and reveal conserved mechanisms of retrograde protein trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.