Recombinant Schizosaccharomyces pombe ER-derived vesicles protein erv14 (erv14)

Shipped with Ice Packs
In Stock

Description

Erv14 Function and Homologues

Saccharomyces cerevisiae protein Erv14, also known as cornichon, necessitates the incorporation of cargo proteins into COPII vesicles .

  • Erv14 assists in the transport of multiple transmembrane proteins involved in polarized growth .

  • Spo14 is an S. pombe homologue of the budding yeast Sec12 that is essential for vesicle budding from the ER .

  • In S. pombe, Spo14 plays a crucial role in membrane traffic from the ER to the Golgi apparatus, possibly by regulating Psr1 activity .

Erv14 in Vesicle Transport

Erv14 is enriched in COPII vesicles and required for incorporating cargo proteins into these vesicles . Export of secretory proteins from the ER relies on COPII complexes on the ER membrane, which drive the formation and budding of COPII-coated vesicles .

Erv14 and Phosphorylation

Phosphorylation of Erv14 impacts its function and incorporation into COPII vesicles . A phosphorylation consensus site (S134) at the C-terminus of Erv14 is important . Mimicking phosphorylation of S134 prevents the incorporation of Erv14 into COPII vesicles, delays cell growth, modifies ER structure, and affects the localization of several plasma membrane transporters . A possible cycle of phosphorylation and dephosphorylation is important for the correct functioning of Erv14 .

Erv14 Interactions and Impact

Deletion of Erv14 severely inhibits mycelial growth and the secretion of extracellular proteins, such as glucoamylase, in Aspergillus niger .

  • Erv14 interacts with a variety of transmembrane transporter proteins .

  • Multiple proteins associated with the cell wall and lipid metabolism were reduced due to the deletion of Erv14 .

spo14 Gene and its Role

The Schizosaccharomyces pombe spo14 mutant was originally isolated as a sporulation-deficient mutant, with the spo14 gene essential for cell viability and growth . In spo14 mutant cells, ER-like membranes accumulate beneath the plasma membrane, and the ER/Golgi shuttling protein Rer1 remains in the ER .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
erv14; SPAC30C2.05; ER-derived vesicles protein erv14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erv14
Target Protein Sequence
MMSFGSFVYIACLLLNGANMLLQIFCVIMFSDLEMDYINPIDLCNKLNDLVMPEIISHTL VTLLLLLGKKWLLFLANLPLLVFHANQVIHKTHILDATEIFRQLGRHKRDNFIKVTFYLI MFFTLLYCMVMSLIQEE
Uniprot No.

Target Background

Function
Regulates the export of secretory proteins from the endoplasmic reticulum via COPII-coated vesicles.
Database Links
Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How is recombinant S. pombe Erv14 typically produced and purified?

Recombinant S. pombe Erv14 is commonly produced in E. coli expression systems with an N-terminal His-tag to facilitate purification. The protein is expressed as a full-length construct (1-137 amino acids) and is typically available as a lyophilized powder after purification . The purification process typically involves:

  • Expression in E. coli using standard recombinant protein production methods

  • Cell lysis to release the protein

  • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Concentration and buffer exchange

  • Lyophilization for storage

The final product generally reaches >90% purity as determined by SDS-PAGE analysis and is stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What are the recommended storage and handling conditions for recombinant Erv14?

For optimal stability and activity of recombinant S. pombe Erv14:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots may be stored at 4°C for up to one week

How does post-translational modification affect Erv14 function?

Post-translational modifications, particularly phosphorylation, play a critical role in regulating Erv14 function. Studies in S. cerevisiae have identified a phosphorylation consensus site (S134) at the C-terminus of Erv14 that significantly impacts its activity and localization .

The effects of phosphorylation state on Erv14 function can be summarized in the following table:

Phosphorylation StateExperimental MimicEffects on Erv14 Function
PhosphorylatedS134D mutation- Prevents incorporation of Erv14 into COPII vesicles
- Delays cell growth
- Exacerbates growth defects in sec mutants
- Modifies ER structure (separation from cell periphery)
- Affects localization of several plasma membrane transporters
DephosphorylatedS134A mutation- Less severe effects than S134D
- Still modifies ER structure (causes omega-like deformations)
- Slows cell growth
- Affects trafficking of certain cargo proteins

These findings suggest that a regulated cycle of phosphorylation and dephosphorylation is essential for the proper functioning of Erv14. This cycle likely controls the incorporation of Erv14 into COPII vesicles and consequently regulates the trafficking of its cargo proteins .

What experimental approaches can be used to study Erv14-dependent cargo trafficking?

Several methodological approaches have proven effective for investigating Erv14-dependent cargo trafficking:

  • Fluorescence microscopy with GFP-tagged constructs:

    • Creating Erv14-GFP fusions to monitor subcellular localization

    • Co-expressing Erv14 variants with GFP-tagged cargo proteins (e.g., Pdr12-GFP, Qdr2-GFP) to assess trafficking efficiency

    • Analyzing ER-to-Golgi transport using time-lapse imaging

  • Mutational analysis:

    • Generating phosphomimetic (S134D) and phospho-dead (S134A) mutants

    • Creating deletion strains (erv14Δ) complemented with wild-type or mutant versions

    • Analyzing the effects of mutations on protein trafficking and cellular phenotypes

  • Ultrastructural analysis:

    • Transmission electron microscopy (TEM) to examine ER morphology changes

    • Quantification of structural alterations (e.g., omega-like structures, cortical ER separation)

  • Growth assays:

    • Comparing growth rates of strains expressing different Erv14 variants

    • Assessing genetic interactions with secretory pathway mutants (sec mutants)

  • In vitro vesicle budding assays:

    • Reconstituting COPII vesicle formation with purified components

    • Assessing incorporation of Erv14 and its cargo into vesicles

How does the Erv14 cytosolic motif contribute to COPII binding and ER exit?

The cytosolic motif of Erv14 plays a crucial role in its interaction with the COPII coat and subsequent ER exit. In S. cerevisiae, a specific cytosolic motif (IFRTL) has been identified as essential for COPII binding and ER exit of the receptor .

The mechanism of Erv14-mediated cargo export appears to involve:

  • Recognition of cargo proteins, potentially through:

    • Identification of long transmembrane domains (TMDs) characteristic of plasma membrane proteins

    • Interaction between cargo proteins and residues in the second TMD of Erv14

  • Formation of a dual interaction system:

    • Erv14 simultaneously binds to cargo proteins and the COPII coat (specifically the Sec24 subunit)

    • This dual binding enables efficient packaging of cargo into COPII vesicles

  • Potential regulatory mechanisms:

    • The C-terminal acidic motif (ESXDD) found in fungi and plant homologs serves as an interaction site with cargo proteins

    • Phosphorylation within this motif (at S134) modulates Erv14 activity and cargo selection

This model positions Erv14 as a classical cargo receptor that facilitates the export of specific membrane proteins from the ER by creating a bridge between these proteins and the COPII coat machinery.

What are the structural changes in the ER associated with Erv14 mutations?

Transmission electron microscopy (TEM) studies have revealed distinct ultrastructural changes in the ER associated with different Erv14 mutations:

  • Wild-type Erv14: Cells show clear continuous cortical ER at the TEM level

  • S134D mutation (phosphomimetic):

    • Causes separation of the cortical ER from the cell's periphery

    • Does not induce omega-like deformations of the ER

  • S134A mutation (phospho-dead):

    • Results in a deformed cortical ER

    • Creates numerous omega-like structures distributed along the organelle

    • These structural deformations may reflect altered trafficking dynamics between the ER and Golgi

These observations suggest that the phosphorylation state of Erv14 significantly impacts ER morphology, likely through effects on membrane trafficking and cargo selection. The specific mechanisms by which Erv14 phosphorylation regulates ER structure remain an area for further investigation.

How does Erv14 phosphorylation state affect trafficking of specific cargo proteins?

The phosphorylation state of Erv14 differentially affects the trafficking of various cargo proteins. Studies with specific transporters have revealed complex patterns:

  • Pdr12 (ABC family transporter):

    • Correctly delivered to the plasma membrane when co-expressed with wild-type Erv14 or Erv14-S134A

    • Retained in the ER when co-expressed with Erv14-S134D or in erv14Δ cells

  • Qdr2 (MFS family exchanger):

    • Properly targeted to the plasma membrane with either wild-type Erv14 or Erv14-S134D

    • Mislocalized when co-expressed with Erv14-S134A or in erv14Δ cells

This cargo-specific effect suggests that different membrane proteins may have distinct requirements for Erv14 phosphorylation status. The molecular basis for this selectivity likely involves specific interactions between cargo transmembrane domains and regions of Erv14 that are conformationally altered by phosphorylation .

A model emerges where a regulated cycle of Erv14 phosphorylation and dephosphorylation may control the temporal and spatial aspects of cargo protein trafficking, potentially allowing for prioritization of certain cargoes under specific cellular conditions.

What are the challenges in studying S. pombe Erv14 compared to S. cerevisiae Erv14?

Several challenges exist when studying S. pombe Erv14 compared to its more extensively characterized S. cerevisiae counterpart:

  • Limited specific studies: Most detailed mechanistic studies have focused on S. cerevisiae Erv14, with fewer investigations specifically targeting S. pombe Erv14

  • Sequence and structural differences: While functionally related, sequence variations between the orthologs may result in differences in:

    • Cargo recognition specificity

    • Regulatory mechanisms

    • Protein-protein interactions

  • Experimental system considerations: S. pombe and S. cerevisiae differ in aspects of:

    • Cell cycle regulation

    • Cell morphology and growth

    • Organization of the secretory pathway

    • Post-translational modification systems

These differences necessitate careful validation when extrapolating findings from one yeast species to another. Researchers should consider developing S. pombe-specific tools and assays rather than relying solely on approaches established in S. cerevisiae.

How can evolutionary conservation analysis inform Erv14 functional studies?

Evolutionary analysis of the Erv14/cornichon family across species can provide valuable insights:

  • Conservation mapping:

    • Highly conserved regions likely represent functionally critical domains

    • Species-specific variations may reflect adaptation to different cellular environments or cargo requirements

  • Motif analysis:

    • The acidic motif (ESXDD) at the C-terminus is present only in fungi and plants, not in higher organisms

    • This suggests potentially divergent regulatory mechanisms across evolutionary lineages

  • Functional homology:

    • S. pombe Rec14 has been identified as a functional homolog of S. cerevisiae Rec103 based on amino acid sequence similarities and mutant phenotypes

    • Similar comparative approaches could clarify the functional relationships between Erv14 proteins across species

Such evolutionary analyses can guide experimental design by highlighting regions for targeted mutagenesis and suggesting candidate interacting proteins or regulatory mechanisms to investigate.

What expression systems are optimal for producing functional recombinant S. pombe Erv14?

The optimal expression system for producing functional recombinant S. pombe Erv14 depends on the intended application:

  • E. coli expression:

    • Most commonly used for high-yield production

    • Suitable for structural studies and antibody generation

    • Usually requires His-tagging for purification

    • May require optimization of codon usage and growth conditions

    • Typically yields protein at >90% purity

  • Yeast expression systems:

    • S. cerevisiae or S. pombe systems may provide more native post-translational modifications

    • Useful for functional studies requiring proper protein folding and modification

    • Lower yield but potentially higher functionality

    • Can be used with genomic integration or plasmid-based expression

  • Reconstitution considerations:

    • Recombinant Erv14 is typically supplied as a lyophilized powder

    • Recommended reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for storage stability

    • Storage at -20°C/-80°C, with working aliquots at 4°C for up to one week

What methods are effective for studying the interactions between Erv14 and its cargo proteins?

Several complementary approaches have proven effective for investigating Erv14-cargo interactions:

  • Genetic methods:

    • Creation of deletion strains (erv14Δ) to identify Erv14-dependent cargo

    • Suppressor screens to identify genetic interactions

    • Synthetic genetic arrays to map interaction networks

  • Microscopy techniques:

    • Fluorescent protein tagging to monitor co-localization

    • FRAP (Fluorescence Recovery After Photobleaching) to study dynamic interactions

    • Super-resolution microscopy for detailed spatial analysis

  • Biochemical approaches:

    • Co-immunoprecipitation to detect physical interactions

    • Pull-down assays with recombinant proteins

    • Crosslinking coupled with mass spectrometry to identify interaction sites

  • Structural analysis:

    • X-ray crystallography or cryo-EM to determine atomic structures

    • Molecular dynamics simulations to model interactions

    • Site-directed mutagenesis to validate interaction models

  • Functional assays:

    • In vitro vesicle budding assays

    • Cargo trafficking assays using fluorescent reporters

    • Membrane topology mapping using protease protection assays

The combination of these approaches provides a comprehensive understanding of how Erv14 recognizes, binds, and facilitates the transport of its diverse cargo proteins.

What are the broader implications of understanding S. pombe Erv14 function in cellular biology?

Understanding S. pombe Erv14 function has significant implications across multiple areas of cell biology:

  • Fundamental membrane trafficking mechanisms:

    • Insights into how cargo receptors selectively package proteins into transport vesicles

    • Understanding of the role of post-translational modifications in regulating trafficking

    • Elucidation of mechanisms controlling ER structure and organization

  • Evolutionary perspectives:

    • Comparing Erv14 function across species reveals conserved and divergent aspects of membrane trafficking

    • Identification of fundamental principles governing protein transport in eukaryotic cells

  • Disease relevance:

    • Cornichon proteins in higher organisms are implicated in neurological disorders and development

    • Understanding basic mechanisms in yeast models provides insights into human disease processes

  • Biotechnology applications:

    • Potential manipulation of secretory pathway efficiency for protein production

    • Development of tools to control membrane protein trafficking

    • Engineering of yeast strains with modified protein secretion profiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.